{"title":"Fresh Water Pearls","description":"","products":[{"product_id":"elegant-vintage-pearl-necklace","title":"Vintage Fresh Water Pearl Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eWrap your neckline in quiet luxury with the Elegant Vintage Fresh Water Pearl Necklace. Designed to sit close to the collarbone, it layers three slender strands of tiny freshwater pearls into a soft, dimensional silhouette. At the front, a single accent bead provides a subtle focal point, its creamy-white tones with a delicate iridescent glow catching light in a refined, nuanced way.\u003c\/p\u003e \u003cp\u003eThis necklace stands out through its graceful balance of presence and restraint. The three-layer design adds just enough texture to elevate everyday outfits, while the neutral palette keeps the look timeless and versatile. It isn’t flashy—it's refined, organic, and engineered to pair with almost anything in your wardrobe.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eThree slender strands\u003c\/strong\u003e rest close to the neckline for a refined, collarbone-skimming silhouette that adds depth without bulk.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eFront-facing accent bead\u003c\/strong\u003e acts as a soft focal point, delivering a gentle sparkle without dominating the piece.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCreamy white to iridescent tones\u003c\/strong\u003e create a versatile, luminous palette that stays elegant across lighting and fabrics.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eMinimalist, organic aesthetic\u003c\/strong\u003e—neutral hues that pair effortlessly with silk blouses, cotton shirts, denim, or gowns.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWho this is for\u003c\/strong\u003e: Minimalists who value understated luxury, fans of vintage-inspired jewelry seeking a modern, wearable interpretation, and anyone looking for a versatile necklace that transitions from day to night with ease. It also makes a timeless, distinctive gift for someone who appreciates quiet charm and refined silhouettes.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eReal-world wear and styling ideas\u003c\/strong\u003e:\n- Pair with a crisp white shirt for a polished office look, or soften a little black dress with its pearlescent glow.\n- Layer it with a shorter chain for a contemporary, curated stack, or wear solo so the focal bead shines.\n- Its neutral tones make it a reliable companion for weddings, dinners, or weekend brunches alike.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e: After wearing, wipe pearls and beads with a soft, lint-free cloth. Store in a breathable pouch away from direct sunlight and humidity. Minimize exposure to perfumes, lotions, and household chemicals, and put on the necklace after applying beauty products to preserve its luster.\u003c\/p\u003e \u003cp\u003eElevate your everyday look with a necklace built on quiet confidence. The Elegant Vintage Fresh Water Pearl Necklace delivers refined, versatile charm that enhances your style without shouting for attention.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"My Store","offers":[{"title":"Default Title","offer_id":46132329545881,"sku":null,"price":32.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/4_22f636d3-2979-43ab-a047-665c5fd9f4c5.jpg?v=1770321938"},{"product_id":"timeless-black-pearl-earrings","title":"Elegant Black Pearl Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eThe \u003cstrong\u003eElegant Black Pearl Earrings\u003c\/strong\u003e blend a smooth, pearl-toned center with a warm gold-tone square frame, delivering understated luxury for everyday finesse. The iridescent center catches the light with a gentle shimmer, designed to flatter a wide range of skin tones while the organically shaped gold-tone frame introduces a contemporary geometric contrast to a timeless pearl motif.\u003c\/p\u003e \u003cp\u003eDesigned for seamless transitions from desk to dinner, these earrings are incredibly lightweight and comfortable for all‑day wear. You’ll forget you’re wearing them as you switch from focused work to after‑hours plans, all while staying polished and put‑together.\u003c\/p\u003e \u003cp\u003eWhat makes them stand out:\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eDistinctive contrast\u003c\/strong\u003e — a modern gold-tone square frame wraps a pearl-toned center, offering a refined geometric twist on a classic pearl design.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSoft, versatile shimmer\u003c\/strong\u003e — the pearl-toned centerpiece provides a subtle, eye-catching glow that enhances neutrals, prints, and metallics without overpowering your outfit.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eFeatherweight comfort\u003c\/strong\u003e — lightweight construction paired with a secure fit ensures all‑day wearability without fatigue.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow‑maintenance care\u003c\/strong\u003e — simply wipe with a soft cloth after wear and store away from harsh elements to preserve glow and finish.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eIdeal for: professionals seeking an understated yet impactful accessory that complements tailored workwear and casual outfits alike; students, travelers, or anyone building a polished, versatile jewelry capsule. They also make a thoughtful gift for birthdays, anniversaries, or a curated “refined essentials” moment for someone who appreciates elegant simplicity with a modern edge.\u003c\/p\u003e \u003cp\u003eUse cases and styling ideas:\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003ePair with a crisp blouse and blazer for a confident office look that transitions effortlessly into an after‑work dinner.\u003c\/li\u003e \u003cli\u003eMatch with a printed dress or metallic‑accented ensemble to add a subtle focal point without competing for attention.\u003c\/li\u003e \u003cli\u003eLayer with other minimal pieces for a streamlined, cohesive jewelry moment that feels intentional and chic.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003c\/div\u003e","brand":"My Store","offers":[{"title":"Default Title","offer_id":46132520517785,"sku":null,"price":27.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/6_dbd9ae46-44cd-49b9-9e75-8862783b4853.jpg?v=1770321954"},{"product_id":"golden-thread-pearl-vintage-earrings","title":"Golden Thread Pearl Vintage Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eGolden Thread Pearl Vintage Earrings fuse timeless elegance with everyday wearability. The gently rounded, pearl-like drops radiate a soft, natural glow, while a delicate golden-toned thread wraps just near the top to form a refined cap. Subtle bead detailing adds texture and nuance, creating a boutique finish without adding bulk.\u003c\/p\u003e \u003cp\u003eWhat makes these earrings stand out is the thoughtfully balanced design. The lightweight, balanced construction feels nearly effortless to wear all day or glide you from coffee dates to evening plans. They bring a touch of vintage charm to modern wardrobes, pairing effortlessly with neutrals, metallics, and soft fabrics to let your personal style shine.\u003c\/p\u003e \u003ch3\u003eWhy the Golden Thread Pearl Vintage Earrings matter\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003ePearl-inspired drops with an organic silhouette\u003c\/strong\u003e flatter every face shape and skin tone, offering a timeless look without heavy drama.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eFine wire wrapping at the top\u003c\/strong\u003e provides a subtle, craft-inspired accent that remains elegant and understated.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eTiny bead detailing\u003c\/strong\u003e adds tactile texture and visual interest for a refined, boutique feel.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight, balanced construction\u003c\/strong\u003e delivers all-day comfort, so you can wear them from desk to dinner without fatigue.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVintage-inspired charm meets modern wearability\u003c\/strong\u003e—a versatile staple that enhances both casual outfits and polished looks.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho benefits most\u003c\/h3\u003e\n\u003cp\u003eIdeal for anyone seeking a versatile staple that transitions from work to weekend, from a soft blouse to a little-black-dress moment. Perfect for lovers of understated glamour who want a classic, sophisticated touch without heavy statement pieces. They also make a thoughtful gift for someone who appreciates timeless jewelry with a wearable, contemporary twist.\u003c\/p\u003e \u003ch3\u003ePractical styling and care tips\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eWear with hair swept back to let the glow of the drops illuminate your features.\u003c\/li\u003e \u003cli\u003ePair with light knits or silk blouses to amplify the warm, inviting tones of the pearl-like drops.\u003c\/li\u003e \u003cli\u003eStore in a soft pouch to protect the delicate bead textures that give this piece its distinctive character.\u003c\/li\u003e \u003cli\u003eClean with a soft, dry cloth and avoid harsh chemicals to preserve the finish of the gold-toned thread.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eIn short, the Golden Thread Pearl Vintage Earrings offer a rare blend of vintage softness and contemporary ease. They’re not just an accessory; they’re a wearable moment of elegance that elevates everyday looks and upscales special occasions alike.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"My Store","offers":[{"title":"Default Title","offer_id":46132538081433,"sku":null,"price":39.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/11_ecbf812f-5f5b-4ed1-8e28-6a4f3a1cb395.jpg?v=1770321965"},{"product_id":"exquisite-pearl-layered-bracelet-set","title":"Exquisite Pearl Bracelet Set","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the \u003cstrong\u003eExquisite Pearl Bracelet Set\u003c\/strong\u003e—a refined collection that merges timeless pearl beauty with modern, effortless wear. Softly rounded pearl beads are masterfully arranged in layered strands, with a thoughtful variation in bead sizes that creates a gentle, fluid movement. The result is a bracelet set that feels alive on your wrist without overpowering your look.\u003c\/p\u003e \u003cp\u003eThis design’s standout attribute is its \u003cstrong\u003eperfect balance\u003c\/strong\u003e: \u003cstrong\u003elightweight\u003c\/strong\u003e, proportioned, and designed to glide on with ease, staying comfortable from morning meetings to evening plans. The combination of subtle metallic accents and a delicate heart charm adds a touch of personal warmth, turning a simple accessory into a meaningful statement that remains professional and polished.\u003c\/p\u003e \u003ch3\u003eWhy this set stands apart\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eDynamic movement\u003c\/strong\u003e thanks to varying bead sizes that catch the light and follow your gestures, avoiding the stiffness of uniform strands.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLayered versatility\u003c\/strong\u003e—wear the strands together for a fuller, statement look or separate them for a minimalist glow that still elevates your outfit.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEmotional detail\u003c\/strong\u003e—the heart charm offers a subtle, personal touch without shouting, making it ideal for gifting or thoughtful self‑purchasing.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eAll‑day comfort\u003c\/strong\u003e—crafted to stay with you from desk to dinner, this set prioritizes wearability without sacrificing sophistication.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eIdeal for\u003c\/h3\u003e\n\u003cp\u003eThe Exquisite Pearl Bracelet Set is crafted for the modern woman who values versatility. It transitions seamlessly from a crisp work blouse to after‑hours brunch, and pairs beautifully with a watch for a refined evening look. Whether you’re building a curated jewelry capsule or seeking gifts that feel personal yet understated, this set delivers.\u003c\/p\u003e \u003ch3\u003eUse cases and styling ideas\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003ePair with a tailored blouse for a warm, inviting glow at the office.\u003c\/li\u003e \u003cli\u003eStack the strands with the bracelet next to your watch for a chic, cohesive evening ensemble.\u003c\/li\u003e \u003cli\u003eWear the pieces separately for a minimalist approach or together for a fuller, dimensional feel.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cp\u003eTo keep the set pristine, handle with care and avoid prolonged exposure to water. Store gently to preserve the bead luster and the delicate heart charm. With mindful care, this bracelet set remains a timeless addition to your wardrobe, ready to elevate countless outfits over the years.\u003c\/p\u003e \u003cp\u003eIn a world of ordinary jewelry, the Exquisite Pearl Bracelet Set offers a distinctive blend of movement, emotion, and versatility—allowing you to express personality through sophisticated detail that feels intentional and refined.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"My Store","offers":[{"title":"Default Title","offer_id":46135359537305,"sku":null,"price":35.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/1_edc766d9-0496-41a5-83b1-05cbe1864463.jpg?v=1770321973"},{"product_id":"graceful-pearl-dangling-earrings","title":"Noble Pearl Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the \u003cstrong\u003eElegant Pearl Dangling Earrings\u003c\/strong\u003e — a refined, day-to-night piece that elevates every moment with quiet confidence. Designed to feel effortless from desk to dinner, these \u003cstrong\u003epearl drop earrings\u003c\/strong\u003e move with you, delivering a subtle shimmer without overpowering your look.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003ePearl-inspired elegance:\u003c\/strong\u003e round, smooth accents that catch the light with every turn of your head\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSlim, curved hooks:\u003c\/strong\u003e comfortable wear and a secure, everyday fit that won’t snag hair or clothing\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eFluid silhouette:\u003c\/strong\u003e gentle movement and clean lines that transition seamlessly from workday to evening\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling:\u003c\/strong\u003e complements metallics, neutrals, or patterns, making them ideal for workwear, weekend outfits, and more formal occasions\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eCrafted for those who appreciate understated luxury, these earrings add a refined touch to your daily wardrobe and elevate dressier moments without overpowering your look. Their minimal grace pairs beautifully with a crisp blouse for the office, a sleek dress for an evening out, or a blazer for a polished, cohesive ensemble.\u003c\/p\u003e \u003ch3\u003eUse cases\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eDaily wear at the office or during casual outings, bringing a subtle shimmer to any look\u003c\/li\u003e \u003cli\u003eSmart-casual dinners and gatherings where a touch of elegance enhances your outfit\u003c\/li\u003e \u003cli\u003eSpecial occasions where a minimal, pearl-inspired accent complements the overall attire\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWith light, graceful movement and a polished finish, these pearl drop earrings invite you to experience refined simplicity you can rely on day after day. Ready to add a timeless, versatile piece to your jewelry collection? Add them to your cart and let the effortless glow speak for your style.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"My Store","offers":[{"title":"Default Title","offer_id":46135363862681,"sku":null,"price":29.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/3_a91e51d3-42bf-4799-88d8-fe7cb2b68d9e.jpg?v=1770321977"},{"product_id":"lustrous-pearl-necklace","title":"Lustrous Pearl Necklace","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003eLustrous Pearl Necklace\u003c\/strong\u003e elevates everyday style with a thoughtfully crafted two-strand design that moves with you, adding a quiet, refined glow to every moment.\u003c\/p\u003e\n\u003cp\u003eThis layered necklace balances two distinct silhouettes into one harmonious piece. One delicate strand features small pearl-like accents that catch the light with every turn, while the other finishes in a simple round pendant that rests gently at the center. The result is a nuanced contrast and fluid articulation that feels both timeless and modern.\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eTwo-layer versatility\u003c\/strong\u003e—wear the strands together for a softly layered statement, or separate them for a more minimal touch that still elevates your neckline.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eFeatherweight comfort\u003c\/strong\u003e—designed to drape gracefully without weighing you down, ideal for all-day wear from morning meetings to evening outings.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCenterpiece balance\u003c\/strong\u003e—the clean, round pendant anchors the look, drawing attention to the collarbone while maintaining an understated aura.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eElegant movement\u003c\/strong\u003e—the interplay between the pearl-like accents and the pendant creates subtle motion that catches the eye as you move.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eFrom casual to dressy\u003c\/strong\u003e—a versatile addition that pairs with a simple tee and jeans or complements a polished dress for special occasions.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003eWho is this for? It’s ideal for lovers of understated luxury who value a necklace that works across settings—from everyday errands to refined events. It also makes a thoughtful gift for someone who appreciates quiet refinement and the artistry of layered jewelry.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eStyling tips\u003c\/strong\u003e — drape the necklace with necklines that frame the collarbone: bateau, deep-V, or square necklines work beautifully. For a curated look, layer with a shorter delicate chain or pair it with simple stud earrings to let the pendant take center stage.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e — to maintain its luster, wipe gently with a soft cloth after wear, store away from humidity, and apply lotions or perfume before putting on the necklace to minimize residue on the pearls and pendant.\u003c\/p\u003e\n\u003cp\u003eEssential for anyone building a versatile jewelry lineup, the Lustrous Pearl Necklace invites you to experience subtle warmth, refined texture, and a touch of radiant charm that enhances both daily ensembles and evening silhouettes.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"My Store","offers":[{"title":"Default Title","offer_id":46135364649113,"sku":null,"price":30.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/4_1aebdc44-b0d3-487d-a013-3e9429017e43.jpg?v=1770321978"},{"product_id":"classic-mint-cabochon-pearl-hoop-earrings","title":"Classic Silver Mint Cabochon Pearl Hoop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eMeet the Classic Silver Mint Cabochon Pearl Hoop Earrings—where a fluid hoop silhouette pairs with a soft mint oval centerpiece for a look that feels deliberately cultured and effortlessly wearable. This isn’t just an earring; it’s a statement that moves with you, recalling vintage charm while staying distinctly modern.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eSignature curved hoop\u003c\/strong\u003e: a graceful, rounded profile that glides with your day, delivering a sculptural footprint without adding bulk or heaviness.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCentral oval cabochon\u003c\/strong\u003e: a mint-toned centerpiece that brings a gentle pop of color and a pearl-like glow, elevating everything from basics to evening looks.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLayered texture\u003c\/strong\u003e: subtle, rounded accents along the hoop create depth and dimension from every angle—built-in detail that catches the eye without shouting.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight comfort\u003c\/strong\u003e: designed for all-day wear, these earrings transition seamlessly from desk to dinner with a barely-there feel.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e: pairs beautifully with casual denim, polished office looks, or a thoughtfully chosen outfit for a refined finish.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eTimeless color story\u003c\/strong\u003e: the cool silver-toned hoops form a timeless backdrop that complements a wide palette—from crisp whites to rich jewel tones, while the mint cabochon adds a delicate, wearable color accent.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWhy this design matters: the mint cabochon centerpiece isn’t just a color—it's a focal point that brightens the face and adds a whisper of vintage whimsy. The silver-toned hoop offers a clean, versatile backdrop that suits a range of personal styles, making these earrings a reliable go-to for daily wear or special occasions.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e: to preserve the mint hue and pearl-like glow, wipe gently with a soft cloth after wear, store separately to prevent scratching, and avoid contact with lotions, perfumes, and harsh chemicals. With proper care, the mint centerpiece stays vibrant and the silver-toned hoop keeps its luster over time.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eIdeal for\u003c\/strong\u003e: anyone drawn to understated elegance with a touch of color and texture. These earrings work as a thoughtful gift for birthdays, anniversaries, or as a just-because moment—delivering a polished finish that never feels overdone.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"My Store","offers":[{"title":"Default Title","offer_id":46135381393561,"sku":null,"price":27.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/1_b38d704d-e1e2-498a-bef6-af3f2981ba1a.jpg?v=1770321993"},{"product_id":"helena-inspired-classic-pearl-earrings","title":"Classic Pearl Helena Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eThe Classic Pearl Helena Earrings fuse timeless pearl elegance with a modern, fluid silhouette, designed to become a signature detail in your everyday wardrobe.\u003c\/p\u003e\n\u003cp\u003eSleek teardrop pearls dangle from slim, softly curved hooks, creating a graceful line that moves as you do. The design Playfully contrasts luminous white pearls against warm-toned metal, delivering a sophisticated glow that flatters a wide range of skin tones without overpowering your look.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eMinimalist, uninterrupted drop\u003c\/strong\u003e: a clean, continuous silhouette that pairs effortlessly with necklines and hairstyles, from knitwear to tailored blazers.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eAll-day comfort\u003c\/strong\u003e: the slim hooks glide with your movement, reducing tugging and staying securely in place from desk to dinner.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eWarmth with radiance\u003c\/strong\u003e: warm metal hues enhance the pearls’ pearlescence, creating a refined balance that reads as polished but approachable.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e: elevates casual outfits and complements formal ensembles, making them a reliable go-to for any occasion.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eIdeal for whom and when\u003c\/h3\u003e\n\u003cp\u003eThe Classic Pearl Helena Earrings are perfect for anyone seeking understated glamour—professional everyday wear, weekend outings, or date nights where you want a touch of refined charm without distraction. They also make a thoughtful gift for someone who appreciates the quiet luxury of classic pearls with a contemporary edge.\u003c\/p\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cp\u003eTo keep the pearls and metal looking their best, wipe gently with a soft microfiber cloth after wear and store in a protective pouch. Avoid direct contact with perfumes, lotions, and harsh chemicals, which can dull the pearl’s luster over time.\u003c\/p\u003e \u003cp\u003eExperience the quiet sophistication of the Classic Pearl Helena Earrings—where a simple drop becomes a signature detail. Add to cart to elevate your everyday looks with a timeless refinement.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"My Store","offers":[{"title":"Default Title","offer_id":46135455711385,"sku":null,"price":26.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/2_cdce409c-08ec-4003-9731-a47deb1c7508.jpg?v=1770322005"},{"product_id":"baroque-turquoise-necklace-bohemian-beaded-choker-elegant-imitation-pearl-beach-vacation-necklaces-womens-vacation-jewelry","title":"Baroque Turquoise Beaded Pearl Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Baroque Turquoise Beaded Pearl Necklace — a bohemian‑meets‑refined statement piece that sits gracefully at the collarbone. Crafted as a beaded choker, it blends vivid turquoise beads with imitation pearls for a texture-rich accessory that elevates any neckline.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eDistinctive texture and silhouette:\u003c\/strong\u003e baroque-inspired beading paired with imitation pearls creates a tactile focal point that adds depth to neutrals and brings interest to printed fabrics.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eChoker-length design:\u003c\/strong\u003e engineered to rest at the collarbone, it complements sundresses, off‑the‑shoulder tops, and simple tees while keeping the look light and comfortable.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eAll‑day comfort:\u003c\/strong\u003e crafted without heavy metal components, so you can wear it through vacation activities, beach days, and dinners without irritation.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eDay-to-night versatility:\u003c\/strong\u003e transitions effortlessly from sunlit beach vacation scenes to resort dinners or casual evenings out, making it a practical travel piece.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVibrant yet versatile color:\u003c\/strong\u003e the turquoise with imitation pearl accents creates a lively, yet neutral palette that suits a wide range of skin tones and outfit choices.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eThis necklace is ideal for vacation outfits, beach days, and everyday wear. It pairs beautifully with sundresses, off-the-shoulder silhouettes, and simple tees, while enhancing neutrals and adding a pop to printed fabrics. If you’re shopping for a standout piece that harmonizes with both relaxed resort wear and casual city looks, this Baroque Turquoise Beaded Pearl Necklace delivers a distinctive, travel-friendly option that you’ll reach for again and again.\u003c\/p\u003e \u003cp\u003eWhy settle for ordinary when you can wear a textured, color-rich necklace that brings boho charm and baroque detail to every moment? Add this versatile turquoise treasure to your jewelry collection and enjoy a piece designed to travel as boldly as you do.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46178043953305,"sku":"SKU_1771478400905_204","price":27.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/Sbbebc67da90d43609df1d694da981b51Q.webp?v=1772828569"},{"product_id":"vintage-style-finger-ring-inlaid-faux-pearls-boho-finger-rings-for-women-party-jewlery","title":"Classic Silver Orbit Pearl Ring","description":"\u003cdiv\u003e\n\u003cp\u003eThe Classic Silver Orbit Pearl Ring blends a luminous pearl with a delicate orbit of polished silver, delivering a look that’s effortlessly sophisticated and distinctly modern. This is the kind of piece that elevates daily outfits and adds celestial polish to special occasions alike.\u003c\/p\u003e \u003cp\u003eCentered by a single, lustrous pearl, the design draws the eye with iridescent character that ages beautifully with wear. The orbit setting—a slim, sculpted arc of sterling silver—wraps the pearl in a negative-space silhouette that feels airy, refined, and uniquely yours. \u003c\/p\u003e \u003cp\u003eComfort-first design is built for real life: a streamlined band and a smooth interior ensure easy wear from morning meetings to evening outings, without sacrificing presence. \u003c\/p\u003e \u003cp\u003eVersatile styling makes it a flexible addition to any jewelry collection. Pair it with minimalist stackables for a contemporary cascade, or let it stand alone as a quiet statement with a single pendant. It’s the kind of ring you reach for when you want a look that’s refined but never fussy.\u003c\/p\u003e \u003cp\u003eMeaningful gift option—perfect for anniversaries, birthdays, or “just because”—this ring communicates understated romance and a taste for enduring design. Its timeless-meets-modern silhouette is designed for those who appreciate refined simplicity and a piece that grows with your wardrobe season after season.\u003c\/p\u003e \u003ch3\u003eKey details that matter\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eCenterpiece: a single lustrous pearl anchors the design, offering natural iridescence and character.\u003c\/li\u003e \u003cli\u003eSetting: a slim sterling-silver orbit wraps the pearl in airy negative space, creating a unique, contemporary silhouette.\u003c\/li\u003e \u003cli\u003eBand and comfort: streamlined, smooth interior for all-day wear from desk to dinner.\u003c\/li\u003e \u003cli\u003eFinish and care: polished silver with a pearl that ages beautifully; wipe clean with a soft cloth after wear and store separately from other jewelry.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003ePractical styling and living with the ring\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eEveryday elegance: elevates jeans and a tee or a tailored blazer without overpowering your look.\u003c\/li\u003e \u003cli\u003eMix-and-match: pairs beautifully with other jewelry, from stackable bands to a delicate pendant for a cohesive, modern vibe.\u003c\/li\u003e \u003cli\u003eOccasion-ready: a small but striking centerpiece that transitions effortlessly from day events to evening occasions.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare, longevity, and what to expect\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eDurability with care: sterling silver and pearl resist daily wear when you wipe away oils and chemicals after use.\u003c\/li\u003e \u003cli\u003ePrevent scratches: store separately from other pieces to keep the pearl’s luster and the silver’s finish pristine.\u003c\/li\u003e \u003cli\u003eLongevity mindset: gentle cleaning preserves iridescence, helping the pearl maintain its glow over time.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eDesigned for those who value refined simplicity, the Classic Silver Orbit Pearl Ring offers a signature look that feels timeless and intimately modern. It’s a jewelry choice you’ll reach for again and again, season after season.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"5","offer_id":46203413954713,"sku":null,"price":39.95,"currency_code":"USD","in_stock":true},{"title":"6","offer_id":46200630018201,"sku":"SKU_1772127721073_919","price":39.95,"currency_code":"USD","in_stock":true},{"title":"7","offer_id":46200629985433,"sku":"SKU_1772127721073_556","price":39.95,"currency_code":"USD","in_stock":true},{"title":"8","offer_id":46200629952665,"sku":"SKU_1772127721073_489","price":39.95,"currency_code":"USD","in_stock":true},{"title":"9","offer_id":46200629919897,"sku":"SKU_1772127721073_666","price":39.95,"currency_code":"USD","in_stock":true},{"title":"10","offer_id":46200630050969,"sku":"SKU_1772127721073_480","price":39.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/S6113b0744fca4198a498c3bbb5d3af3eT.webp?v=1773195167"},{"product_id":"2026-new-zircon-inlaid-pearl-opening-rings-fashion-jewelry-for-young-girls-wedding-party-luxury-accessories-for-womens-rings","title":"Vintage Adjustable Pearl Zirconia Ring","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Vintage Adjustable Pearl Zirconia Ring — where classic charm meets modern wearability. A luminous pearl anchors the design, embraced by a halo of gleaming zirconia, all wrapped in a vintage-inspired silhouette. The real innovation lies in the adjustable band, designed to fit a range of finger sizes with a comfortable, secure feel so you can wear this piece from day to night and across seasons.\u003c\/p\u003e \u003ch2\u003eTimeless elegance with practical, everyday versatility\u003c\/h2\u003e \u003cp\u003e\u003cstrong\u003eKey features that set it apart\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eAdjustable band for a secure, comfortable fit\u003c\/strong\u003e — this single piece adapts to multiple finger sizes, removing the guesswork of sizing and letting you wear it across different fingers or share it with someone who wears a similar size.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePearl centerpiece with a zirconia halo\u003c\/strong\u003e — a polished pearl takes center stage, while a halo of sparkling zirconia adds just the right amount of shimmer to elevate any look without overpowering it.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVintage-inspired silhouette\u003c\/strong\u003e — refined lines and a graceful profile make this ring a dependable companion for both everyday outfits and special occasions.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSubtle statement that fits any moment\u003c\/strong\u003e — ideal for weddings, anniversaries, date nights, or as a polished everyday accent that complements rather than competes with your style.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho this is for\u003c\/h3\u003e \u003cp\u003ePerfect for lovers of understated elegance who want a piece that grows with them. It’s an ideal gift for bridesmaids, anniversaries, or anyone who cherishes a timeless blend of pearl and sparkle in a versatile accessory.\u003c\/p\u003e \u003ch3\u003eHow it solves common needs\u003c\/h3\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eOne-piece adjustable sizing\u003c\/strong\u003e — no need to reorder or guess at sizes; the band flexes to provide a comfortable fit as you wear it.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday luxury with evening polish\u003c\/strong\u003e — the pearl and zirconia pairing elevates casual outfits while pairing beautifully with dressier looks.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-maintenance elegance\u003c\/strong\u003e — a durable, classic design that stays stylish over time, reducing the need for frequent updates to your jewelry box.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and maintenance\u003c\/h3\u003e \u003cul\u003e \u003cli\u003eKeep the luster shining: remove the ring before swimming or showering, and avoid contact with harsh chemicals.\u003c\/li\u003e \u003cli\u003eWipe the pearl and zirconia with a soft, lint-free cloth after wear to preserve their natural sheen.\u003c\/li\u003e \u003cli\u003eStore separately in a jewelry box or pouch to prevent scratches and keep the pearl’s glow intact.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eSize and adjustment tips\u003c\/h3\u003e \u003cp\u003eTo adjust, gently widen or compress the band until you locate a comfortable, secure fit. The design accommodates micro-adjustments, so you can dial in the exact size you prefer. If you’re unsure about sizing, start with a slightly looser setting and refine after a few days of wear.\u003c\/p\u003e \u003cp\u003eWhether you’re expanding your own collection or searching for a thoughtful gift, the Vintage Adjustable Pearl Zirconia Ring blends heritage-inspired charm with practical, modern wearability. It’s a refined, reliable piece that enhances any ensemble—from a casual brunch to a candlelit evening.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Gold","offer_id":46205219012761,"sku":"SKU_1772296098208_776","price":35.95,"currency_code":"USD","in_stock":true},{"title":"White Gold","offer_id":46208932479129,"sku":null,"price":35.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/S8e85044b74b94021a2cb08bef5210aa3j.webp?v=1773872845"},{"product_id":"huitan-simple-elegant-imitation-pearl-earrings-for-women-metal-silver-color-fashion-versatile-ladys-ear-accessories-new-jewelry","title":"Vintage Golden Pearl Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eMeet the Vintage Golden Pearl Earrings—a refined fusion of timeless pearl luster and a warm golden glow, reimagined in a vintage-inspired drop silhouette. This jewelry feels both historic and instantly wearable, crafted to elevate everyday outfits and lend a touch of magnetic charm to special occasions.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhat makes them uniquely captivating\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003ePearl centerpiece paired with a softly shimmering gold-tone finish for a refined, romantic aesthetic\u003c\/li\u003e \u003cli\u003eDrop design that adds gentle length and movement, drawing attention to the neckline without overpowering your look\u003c\/li\u003e \u003cli\u003eVintage-inspired elegance with a modern, versatile silhouette that pairs with everything from crisp blouses to flowing evening dresses\u003c\/li\u003e \u003cli\u003eWarm pearl glow that complements champagne and ivory palettes while still providing refined contrast with jewel tones\u003c\/li\u003e \u003cli\u003eDay-to-night versatility, ideal for office days that melt into after-work events or weddings and celebrations requiring a timeless accent\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWho this is for\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eLovers of vintage jewelry seeking cohesive, heritage-inspired style\u003c\/li\u003e \u003cli\u003eBridesmaids or wedding guests aiming for a coordinated vintage look\u003c\/li\u003e \u003cli\u003eAnyone wanting a polished, sophisticated accent that enhances outfits without overpowering them\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003ePractical use cases and styling tips\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eFrame a soft neckline or complement a minimalist chain necklace with their classic silhouette\u003c\/li\u003e \u003cli\u003ePair with gold-toned accessories at weddings or formal events to create a cohesive, harmonious aesthetic\u003c\/li\u003e \u003cli\u003eFor everyday wear, team them with a white tee and blazer to add a touch of refined simplicity\u003c\/li\u003e \u003cli\u003eIdeal companions to sheath dresses, tailored blazers, and delicate knits for a single, shimmering focal point\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eTo preserve their luster, wipe with a soft, lint-free cloth after wear and store in a jewelry box or pouch away from humidity and perfumes. Avoid harsh chemicals and prolonged moisture exposure to maintain the pearls’ natural sheen and the warm glow of the gold-tone finish.\u003c\/p\u003e \u003cp\u003eDiscover how the Vintage Golden Pearl Earrings transform your look—bridging classic elegance with everyday practicality, so you feel poised and radiant from desk to dinner and beyond.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Silver","offer_id":46210000289945,"sku":"SKU_1772296231713_9","price":27.95,"currency_code":"USD","in_stock":true},{"title":"Gold","offer_id":46210000322713,"sku":"SKU_1772296231713_10","price":27.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/S75814c4391f2470ba84740a1e8ea5dedo.webp?v=1773195309"},{"product_id":"gorgeous-round-geometry-black-stone-earrings-for-women-gold-color-imitation-pearl-party-dangle-earrings-jewelry","title":"Geometry Black Stone and Pearl Earrings","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003eGeometry Black Stone and Pearl Earrings\u003c\/strong\u003e bring a fresh, sculptural edge to your jewelry box by marrying architectural lines with the pearl’s timeless glow. This is where contemporary design meets everyday wearability, so you don’t have to choose between bold and refined.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eGeometric statement, refined shine:\u003c\/strong\u003e a clean, structured form that catches light from every facet, delivering a subtle architectural charm with every turn of your head.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eStriking contrast:\u003c\/strong\u003e the deep, enigmatic black stone pairs with a luminous pearl for a dual-texture effect that instantly elevates any look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eIncredible versatility:\u003c\/strong\u003e polished enough for the office, chic enough for evenings out, and easy to pair with everything from tailored suiting to casual ensembles.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSeasonless styling:\u003c\/strong\u003e a single pair that transcends trends, helping you build a cohesive modern jewelry capsule you’ll reach for year after year.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful gifting option:\u003c\/strong\u003e a fashion-forward choice for birthdays, anniversaries, or those “just because” moments that deserve a little luxury.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePractical styling guidance:\u003c\/strong\u003e \u003cul\u003e \u003cli\u003eOffice polish: let the geometry take center stage with monochrome outfits—think black, white, or charcoal palettes.\u003c\/li\u003e \u003cli\u003eEvening elegance: pair with a delicate necklace or minimalist rings to create a cohesive, understated look.\u003c\/li\u003e \u003cli\u003eDay-to-night versatility: keep other jewelry simple so the distinctive shape and pearl shine stand out as your signature accessory.\u003c\/li\u003e \u003c\/ul\u003e \u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSimple care routine:\u003c\/strong\u003e wipe gently with a soft, dry cloth after wear to remove oils, then store in a jewelry box or pouch to prevent scratches and tangling.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eDesigned for jewelry lovers who value contemporary design and practical wearability, these earrings offer a unique expression that stands apart from more conventional pieces. If you’re searching for a refined, modern accent that seamlessly blends bold geometry with classic pearl charm, this pair is poised to become a go-to favorite.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46205577822361,"sku":"SKU_1772308348900_367","price":31.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/S301c5f6794414c98a7f5ffd159096eca0.webp?v=1773195443"},{"product_id":"vintage-cross-triangle-pearl-dropping-earrings","title":"Vintage Cross Triangle Pearl Dropping Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eElevate every moment with the Vintage Cross Triangle Pearl Dropping Earrings—a refined fusion of a timeless cross motif, geometric triangle framing, and a luminous pearl drop. This is jewelry that speaks in whispers: sophisticated, never shouty, and built to endure beyond changing trends.\u003c\/p\u003e \u003cp\u003eSignature design that stands apart: a distinctive cross intersecting with a clean triangle silhouette creates a vintage-inspired motif reimagined for today’s wardrobe. The look is instantly recognizable, yet subtle enough to pair with anything from weekend denim to tailored evening wear.\u003c\/p\u003e \u003cp\u003eDelicate pearl drop: a radiant focal point that catches the light with every movement, adding a touch of understated glamour without overpowering your outfit.\u003c\/p\u003e \u003cp\u003eDesigned for everyday wear and special occasions alike, these earrings offer a rare combination of elegance and practicality. They’re lightweight enough for all-day comfort, so you can transition from the office to after-hours with ease, and durable enough to maintain their shine and form through daily use.\u003c\/p\u003e \u003cp\u003eBeyond aesthetics, they’re a thoughtful gift or a personal keepsake—ideal for anniversaries, birthdays, or those spontaneous “why not” moments. Their classic appeal ensures they remain a cherished part of your jewelry rotation for years to come.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhat makes them special\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eDistinctive cross and triangle silhouette that adds story and depth to every look\u003c\/li\u003e \u003cli\u003eGlistening pearl drop that refracts light for a soft, luxurious glow\u003c\/li\u003e \u003cli\u003eLightweight construction for comfortable wear from desk to dinner\u003c\/li\u003e \u003cli\u003eMeticulous crafting designed to hold shine and shape through daily use\u003c\/li\u003e \u003cli\u003eTimeless aesthetics that stay relevant across seasons\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eStore in a soft pouch or jewelry box to prevent scratches and tangling\u003c\/li\u003e \u003cli\u003eAvoid contact with perfumes, lotions, and harsh chemicals to preserve the pearl’s luster\u003c\/li\u003e \u003cli\u003eWipe gently with a soft cloth after wear and keep them dry to maintain their true shine over time\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eReady to add a touch of vintage charm to your collection? The Vintage Cross Triangle Pearl Dropping Earrings offer a refined, versatile statement that elevates any wardrobe and suits any moment—from casual days to special occasions.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46205594468505,"sku":"SKU_1772308631995_842","price":29.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/cb918fd773c4f6441e57dfa13365c7e8.jpg?v=1773195551"},{"product_id":"inlaid-pearls-ring","title":"Handmade Inlaid Pearls Ring","description":"\u003cdiv\u003e\n\u003cp\u003eThe Handmade Inlaid Pearls Ring blends country charm with quiet luxury, crafted for those who want elegance that feels effortless. Each ring is shaped by hand, so no two pieces are exactly alike—and the subtle iridescence of the inlaid pearls catches the light from every angle, adding a shimmering, sophisticated glow to any look.\u003c\/p\u003e \u003ch2\u003eWhat sets this ring apart\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cb\u003eHandcrafted, one‑of‑a‑kind allure:\u003c\/b\u003e Every piece bears small, beautiful imperfections that mark it as distinctly yours, a true artisanal treasure.\u003c\/li\u003e \u003cli\u003e\n\u003cb\u003eInlaid pearls with quiet shimmer:\u003c\/b\u003e Pearls are set to glow softly against a warm golden backdrop, delivering a timeless statement without overpowering your outfit.\u003c\/li\u003e \u003cli\u003e\n\u003cb\u003eWarm, enduring finish:\u003c\/b\u003e A sturdy jewelry‑grade brass base is gently gold plated and sealed with a protective layer to preserve luster and color over time.\u003c\/li\u003e \u003cli\u003e\n\u003cb\u003eTarnish‑resistant protection:\u003c\/b\u003e A durable coating keeps the shine bright whether you’re at holiday parties or weekend errands.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eMaterials, finish, and care you can trust\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cb\u003eBase and plating:\u003c\/b\u003e Jewelry‑grade brass with a soft gold finish for a luxe look that remains comfortable for daily wear.\u003c\/li\u003e \u003cli\u003e\n\u003cb\u003eProtective seal:\u003c\/b\u003e A dedicated coating guards against wear so the ring keeps its warm glow.\u003c\/li\u003e \u003cli\u003e\n\u003cb\u003eHypoallergenic \u0026amp; lead‑free:\u003c\/b\u003e Thoughtfully crafted for sensitive skin and peace of mind when giving as a gift.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eFit, comfort, and everyday practicality\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cb\u003eSizes 6–10\u003c\/b\u003e ensure a comfortable, secure fit for most wearers.\u003c\/li\u003e \u003cli\u003e\n\u003cb\u003eSmooth profile:\u003c\/b\u003e Designed to glide over skin and clothing without snagging, making it suitable for long days and special occasions alike.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eWho it’s for\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eAnyone drawn to a timeless, versatile piece that elevates both casual outfits and formal ensembles.\u003c\/li\u003e \u003cli\u003eGift buyers seeking a handcrafted, low‑maintenance accessory that remains stunning with minimal care.\u003c\/li\u003e \u003cli\u003eShoppers looking for a unique pearl inlay ring that stands apart from mass‑produced designs.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eStyling ideas and use cases\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003ePair with a flowing maxi dress for holiday gatherings or country‑inspired weddings—the pearl accents catch light without overpowering the silhouette.\u003c\/li\u003e \u003cli\u003eDress down a denim and sweater combo with the ring’s subtle pearl glow, adding a touch of pearl‑luxe glamour to everyday wear.\u003c\/li\u003e \u003cli\u003eStack with delicate bands to create a personalized, artisanal vibe that stays sophisticated from morning meetings to evening soirees.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eCare tips to keep it gleaming\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eWipe gently with a soft cloth after wear to remove oils and fingerprints.\u003c\/li\u003e \u003cli\u003eAvoid harsh chemicals and abrasive surfaces to preserve the protective finish.\u003c\/li\u003e \u003cli\u003eStore separately in a soft pouch to prevent scratching and maintain the pearl’s luster.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eElevate your everyday with the Handmade Inlaid Pearls Ring—a distinctive, handcrafted piece that brings an iridescent shimmer and timeless appeal to any look.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"6","offer_id":46205594828953,"sku":"DJED2-WL078001","price":40.95,"currency_code":"USD","in_stock":true},{"title":"7","offer_id":46205594861721,"sku":"DJED2-WL078002","price":40.95,"currency_code":"USD","in_stock":true},{"title":"8","offer_id":46205594894489,"sku":"DJED2-WL078003","price":40.95,"currency_code":"USD","in_stock":true},{"title":"9","offer_id":46205594927257,"sku":"DJED2-WL078004","price":40.95,"currency_code":"USD","in_stock":true},{"title":"10","offer_id":46205594960025,"sku":"DJED2-WL078005","price":40.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/image-2023-11-10T081755.735_3cb33ad2-d064-426f-86ad-ca14d0ffc591.png?v=1773195556"},{"product_id":"antique-irregular-silver-pearl-earrings-white-gold-16k","title":"Antique Irregular Silver Pearl Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eStep into vintage-inspired elegance with the Antique Irregular Silver Pearl Earrings. This pair blends organic baroque pearls set in an antique-silver-tone silhouette, marrying heirloom charm with wearable, modern polish. It’s jewelry that feels storied yet fresh, elevating everyday looks and special-occasion outfits alike.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eUnique irregular pearls\u003c\/strong\u003e: No two pairs are identical. The naturally imperfect shapes catch the light in intriguing ways, delivering a one-of-a-kind sparkle that photographs beautifully and gleams in real life.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eAntique silver finish\u003c\/strong\u003e: A softly aged, timeless hue that flatters both cool and warm skin tones, ensuring the pearls take center stage without clashing with your outfit.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight and comfortable\u003c\/strong\u003e: Thoughtfully designed for all-day wear, you can enjoy a touch of vintage glamour from morning meetings to evening celebrations without fatigue.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e: Perfect for an office ensemble with a tailored blazer, a romantic date night, or as wedding-guest earrings that elevate a minimalist dress or flowy gown alike.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless gifting\u003c\/strong\u003e: A distinctive statement piece for birthdays, anniversaries, or “just because” moments that deserve a little luxury.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWhy these stand apart\u003c\/h3\u003e\n\u003cp\u003eUnlike perfectly round pearls, the irregular baroque shapes offer texture and personality that harmonize with a wide range of palettes. The antique silver finish creates a timeless contrast that enhances both cool and warm tones, making these earrings a flexible addition to any jewelry box.\u003c\/p\u003e \u003ch3\u003eIdeal for whom\u003c\/h3\u003e\n\u003cp\u003eDesigned for jewelry lovers who value character over conformity. If you appreciate vintage mood with contemporary wearability, these earrings are a refined, everyday luxury that transitions seamlessly from desk to dinner or from ceremony to celebration.\u003c\/p\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eWipe gently with a soft, dry cloth after wear.\u003c\/li\u003e \u003cli\u003eStore in a cool, dry place away from moisture and chemicals.\u003c\/li\u003e \u003cli\u003eAvoid contact with fragrances or harsh cleaners to preserve the antique finish and pearlescent glow.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eStyle tips and pairings\u003c\/h3\u003e\n\u003cp\u003ePair with a tailored blazer for a polished office look, a satin or knit dress for a romantic event, or a minimalist silhouette to let the pearls take the spotlight. The blend of baroque pearls and antique silver works beautifully with jewel tones, neutrals, and metallic accents alike, making this pair a versatile cornerstone for your jewelry collection.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46205604266137,"sku":"SKU_1772309141977_982","price":34.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/image_-_2025-01-31T140557.458_900x_38a87e43-0f19-4d9d-a988-17ff8799724f.webp?v=1773195570"},{"product_id":"exquisite-pearl-necklace-white-gold-14k","title":"Exquisite Pearl Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eThe \u003cstrong\u003eExquisite Pearl Necklace\u003c\/strong\u003e elevates every moment with a timeless glow that feels both effortless and unforgettable. Built for those who appreciate quiet luxury, this piece turns any outfit into a statement—whether you’re stepping into a gala, sealing a milestone moment, or adding refined polish to your everyday workwear.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhy this necklace stands out\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eInstant radiance\u003c\/strong\u003e: lustrous pearls with a natural, satin-like sheen that catches the light from every angle, adding a subtle, sophisticated shimmer to your neckline.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile silhouette\u003c\/strong\u003e: a clean, classic strand that drapes gracefully on the collarbone, complementing necklines from boat to deep V without overpowering the wearer.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful craftsmanship\u003c\/strong\u003e: designed to sit comfortably and securely, with a refined clasp that stays in place as you move through the day or night.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday elegance\u003c\/strong\u003e: not just for special occasions—this necklace pairs beautifully with tailored suits, soft knits, or a simple little black dress for everyday confidence and polish.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePerfect gift\u003c\/strong\u003e: an enduring keepsake for birthdays, anniversaries, weddings, or a meaningful \"just because\" that speaks to timeless taste.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWho it’s ideal for\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eBrides seeking a classic, flattering centerpiece that won’t overpower the dress or the moment.\u003c\/li\u003e \u003cli\u003eProfessionals who want a refined, unobtrusive piece that elevates meetings, presentations, andAfter-hours events alike.\u003c\/li\u003e \u003cli\u003ePearl lovers building a versatile jewelry collection—one piece that wears beautifully across seasons and styles.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eWipe gently with a soft, lint-free cloth after wear to remove oils and traces of perfume or cosmetics.\u003c\/li\u003e \u003cli\u003eStore separately in a soft pouch or lined jewelry box to prevent scratches and maintain the pearls’ natural luster.\u003c\/li\u003e \u003cli\u003eAvoid contact with harsh chemicals, chlorine, and extreme temperatures to preserve the pearls’ glow over time.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eStyling tips\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eLet it shine on its own with a minimalist dress for a quiet, evening-ready moment.\u003c\/li\u003e \u003cli\u003eLayer with a delicate pendant or contrasting chain for a modern, eclectic look that still feels refined.\u003c\/li\u003e \u003cli\u003ePair with other pearl accents, such as stud earrings or a slim bracelet, to create a cohesive, elegant set.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eEmbrace a piece that transcends trends. The \u003cstrong\u003eExquisite Pearl Necklace\u003c\/strong\u003e is more than jewelry—it’s a refined expression of timeless charm designed to accompany you through life’s most meaningful occasions and everyday victories alike.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46205604888729,"sku":"SKU_1772309143679_611","price":29.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/image-2023-09-19T140821.010_900x_38bb6547-1ad1-4a20-b57f-621484ec9c2e.webp?v=1773195575"},{"product_id":"vintage-pearl-bracelets-pack","title":"Pearl Bracelet Couture Collection","description":"\u003cdiv\u003e\n\u003cp\u003eTimeless charm meets modern versatility with the Vintage Pearl Bracelets Pack—a carefully curated set of pearl-inspired bracelets designed to elevate every moment, from casual weekends to polished evenings. Each piece glows with a soft, retro luster that captures the essence of vintage jewelry while remaining effortless to wear in today’s wardrobe.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling:\u003c\/strong\u003e wear a single bracelet for a clean, understated touch, or stack multiple pieces for a statement-making look that transitions from day to night.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCoordinated variety:\u003c\/strong\u003e a mix of sizes and subtle metallic accents to complement everything from crisp office wear to a flowing dress, making it easy to create multiple outfits with one pack.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eComfort-first design:\u003c\/strong\u003e lightweight beadwork on durable stringing with smooth finishes ensures comfortable all-day wear, even for extended events.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eGift-ready appeal:\u003c\/strong\u003e a thoughtful, ready-to-gift set that suits birthdays, anniversaries, bridesmaids, weddings, or simply treating someone special to timeless style.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCare for longevity:\u003c\/strong\u003e gentle wipe with a soft cloth after wear and avoidance of harsh chemicals help preserve the pearl-like sheen and luster.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho this is for\u003c\/h3\u003e\n\u003cp\u003eIdeal for jewelry lovers who crave a touch of nostalgia without sacrificing wearability. Great for brides and bridal parties, moms and sisters, or anyone building a versatile jewelry rotation that can be dressed up or down.\u003c\/p\u003e \u003ch3\u003eWhy it stands out\u003c\/h3\u003e\n\u003cp\u003eThis Vintage Pearl Bracelets Pack stands apart with its thoughtfully curated mix that channels vintage glamour while staying adaptable to contemporary outfits. It offers the breadth of a multi-piece set without the clutter of purchasing individual pieces, delivering variety, value, and ease in one elegant package.\u003c\/p\u003e \u003ch3\u003eStyle tips and use cases\u003c\/h3\u003e\n\u003cp\u003eFor a refined daytime look, pair a single pearl-inspired bracelet with a crisp blouse and tailored blazer. For evening glamour, layer a few pieces with slim metallic accents to enhance the pearl glow. Use the pack to create different moods—soft and graceful for weddings, sleek and modern for work, playful layering for weekend casual.\u003c\/p\u003e \u003ch3\u003eCare and storage\u003c\/h3\u003e\n\u003cp\u003eStore in a soft jewelry pouch or lined box to prevent tangling and scratches. After wearing, wipe gently with a soft cloth, and keep away from water, perfumes, and lotions to protect the delicate sheen.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46208301498521,"sku":"SKU_1772476201031_470","price":38.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/openart-gpt-image-2-edit-1_1780164880076_7148060f.jpg?v=1780164926"},{"product_id":"elegant-easy-imitation-pearl-floral-design-copper-ladies-earrings-14k-golden-plated-versatile-for-daily-and-party-occasions","title":"Gold Pearl Blossom Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eImmerse your look in timeless romance with the Gold Pearl Blossom Drop Earrings—where a delicate gold-tone blossom cradles a luminous pearl to create a piece that feels both modern and eternally elegant. The graceful silhouette and radiant pearl work in harmony to elevate any moment, from everyday polish to after-hours sparkle.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eDesign that speaks to nature and refinement\u003c\/strong\u003e\u003cbr\u003e\nA petite floral motif frames a lustrous pearl, delivering a chic, botanical aesthetic. The gold-tone finish adds warmth and versatility, while the pearl’s natural iridescence brings depth to your complexion. The drop design catches light from every angle, ensuring a subtle, eye-catching glow whether you’re at the office, a wedding party, or a weekend soirée.\u003c\/p\u003e \u003ch2\u003eWhat makes these earrings distinctly yours\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eFloral-inspired silhouette:\u003c\/strong\u003e A refined blossom motif that nods to nature without sacrificing modern polish.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eRadiant centerpiece:\u003c\/strong\u003e A luminous pearl that enhances any skin tone with soft, iridescent shimmer.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile glow:\u003c\/strong\u003e Subtle enough for daily wear, yet sophisticated enough to complement formal attire.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless coordination:\u003c\/strong\u003e Pairs beautifully with other gold-tone pieces and pearl accents for a cohesive look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful gifting:\u003c\/strong\u003e An elegant choice for anniversaries, birthdays, bridal parties, or a meaningful treat for yourself.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eWho will love them\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eBridesmaids and wedding guests seeking a timeless, nature-inspired accessory that complements gowns and dresses alike.\u003c\/li\u003e \u003cli\u003eProfessionals aiming to add a refined touch to office-ready outfits that transition to after-work events.\u003c\/li\u003e \u003cli\u003ePearl enthusiasts looking for a versatile piece that blends classic charm with contemporary style.\u003c\/li\u003e \u003cli\u003eGift shoppers pursuing a tasteful, enduring present for anniversaries or special milestones.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eWays to wear\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003ePair with a delicate gold chain bracelet and matching pearl studs for a coordinated, understated set.\u003c\/li\u003e \u003cli\u003eLet the blossom bloom against a sleek, dark dress or a soft, neutral blouse to highlight the pearl’s luster.\u003c\/li\u003e \u003cli\u003eBlend with other gold-tone jewelry—think thin hoops, a slim pendant, or a pearl-accented accent piece—for a cohesive look that remains effortless.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eCare and longevity\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eAfter wear, wipe gently with a soft cloth to preserve shine and remove oils.\u003c\/li\u003e \u003cli\u003eStore away from direct sunlight to protect the pearl’s luster and the gold-tone finish.\u003c\/li\u003e \u003cli\u003eKeep them separate from cosmetics and harsh chemicals to maintain the pearl’s iridescence and the metal’s warmth.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eFrom casual brunch outfits to elegant evening gowns, the Gold Pearl Blossom Drop Earrings bring a refined, nature-inspired glow to any occasion. Experience the subtle drama of a floral motif paired with the timeless appeal of a pearl—and let your style bloom.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210932572313,"sku":"SKU_1772560192710_421","price":31.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/16ca3396-3750-4343-81f3-b4204277c89c.jpg?v=1773196276"},{"product_id":"vintage-geometric-square-distressed-pearl-earrings","title":"Modern Pearl Square Threader Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eElevate your jewelry rotation with the Modern Pearl Square Threader Earrings, where a luminous pearl takes center stage inside a crisp square motif for a contemporary twist on timeless shine. Designed for the modern wearer who appreciates refined luxury, these earrings move effortlessly from daytime polish to evening drama, complementing everything from a tailored blazer to a flowing dress.\u003c\/p\u003e \u003ch2\u003eGeometric elegance meets kinetic movement\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eSquare-inspired pearl centerpiece:\u003c\/strong\u003e A polished pearl framed by a geometric silhouette adds architectural sophistication to classic shine.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThreader versatility:\u003c\/strong\u003e A slender chain slides through the piercing, letting the pearl-led frame drape along the earlobe with adjustable drama.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight, all-day comfort:\u003c\/strong\u003e Delicate yet durable, the design sits gracefully without weighing you down.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless styling:\u003c\/strong\u003e Pairs beautifully with minimalist essentials or statement-making outfits, making it a versatile go-to for any occasion.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eHow to wear and style\u003c\/h2\u003e\n\u003cp\u003eWear these as a long, elegant drop by threading the chain through your piercing and letting the square frame align with the pearl along the lobe. Adjust how much chain sits along the ear to dial in your preferred level of drama—minimal for a clean, daytime look or extended for a more pronounced evening silhouette. The result is a sleek, motion-filled silhouette that catches light from every angle, enhancing a wide range of outfits.\u003c\/p\u003e \u003ch2\u003eCare instructions to preserve luster\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eWipe the pearl gently with a soft cloth after wearing to remove oils and sweat.\u003c\/li\u003e \u003cli\u003eAvoid harsh chemicals and store separately to prevent tangling or abrasion.\u003c\/li\u003e \u003cli\u003eKeep perfumes and hairsprays away from the pearl to preserve its natural luster.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eWho this is for\u003c\/h2\u003e\n\u003cp\u003eIdeal for pearl enthusiasts who crave a modern update, trendsetters seeking a distinctive yet versatile accessory, or anyone looking to refresh their jewelry with a refined, architectural edge. This piece also makes a thoughtful gift for birthdays, anniversaries, or milestones where a touch of contemporary luxury is welcome.\u003c\/p\u003e \u003ch2\u003eWhy choose the Modern Pearl Square Threader Earrings\u003c\/h2\u003e\n\u003cp\u003eThese earrings blend timeless pearl allure with a bold, square geometry and a flexible threader design. The result is a wearable statement that adapts to your day—from a quiet, professional environment to a radiant, social setting—without sacrificing comfort or versatility.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210932899993,"sku":"SKU_1772560226912_433","price":31.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/c5195f58d724881a520dc4e75db3e2b9.jpg?v=1773196277"},{"product_id":"a-pair-of-elegant-ethnic-style-draped-pendant-earrings-inlaid-with-imitation-pearl-decorations-hollow-pattern-design-suitable-for-jewelry-gifts-for-fashionable-street-ladies-to-wear-everyday","title":"Vintage Pearl Talisman Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eStep into timeless glamour with the Vintage Pearl Talisman Drop Earrings—a refined fusion of luminous pearl drops and a talisman-inspired silhouette. These earrings blend classic pearl beauty with a touch of mystique, creating a piece that feels both antique-inspired and forever modern. A radiant pearl drop hangs from a delicate setting that catches and refracts light as you move, adding a subtle, luxe shimmer to every moment.\u003c\/p\u003e \u003cp\u003eWhat makes this pair truly distinctive is the talisman motif—the idea that a protective charm is woven into wearable art. It’s more than jewelry; it’s a storytelling accessory that adds intention and personality to your look.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eStory-driven design.\u003c\/strong\u003e The talisman silhouette invites a personal narrative, elevating everyday elegance with meaning behind the shimmer.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLuminous focal point.\u003c\/strong\u003e A gleaming pearl drop suspended in a meticulous setting captures light from every angle for a soft, radiant glow.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVintage yet wearable.\u003c\/strong\u003e Classic charm meets contemporary practicality, making them easy to style with a range of outfits—from tailored office wear to chic evening looks.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eVersatility designed for real life: these earrings transition from daytime polish to after-hours sophistication. They pair beautifully with wedding-party wardrobes, bridesmaid gowns, or a refined gown for a special occasion, while also adding vintage romance to more casual ensembles like a silk blouse or cashmere sweater.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eIdeal for:\u003c\/strong\u003e jewelry lovers who appreciate a vintage aesthetic with modern wearability, and anyone drawn to pearl pieces that tell a story and seamlessly match both timeless and contemporary outfits.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eStyling ideas:\u003c\/strong\u003e team them with a gemstone-accented dress for a cohesive, elevated look; add a complementary pearl bracelet or delicate necklace for a coordinated set; let the talisman motif shine with a sleek updo or a high-collar blouse.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eCare and handling are simple: store the Vintage Pearl Talisman Drop Earrings in a soft pouch away from moisture and direct sunlight. After wearing, wipe with a gentle, lint-free cloth to remove oils and preserve the pearl’s natural glow for years to come.\u003c\/p\u003e \u003cp\u003eExperience jewelry that feels personal, storied, and distinctly feminine—the Vintage Pearl Talisman Drop Earrings invite light to reveal a tale of vintage charm and modern grace with every turn of your head.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210933915801,"sku":"SKU_1772560291450_111","price":31.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/6997738c-4205-49c8-90a6-b2ae780ffe35.jpg?v=1773196278"},{"product_id":"a-pair-of-freshwater-pearls-earrings-black-baroque-freshwater-pearls-pendant-earrings-girly-freshwater-pearls-stud-earrings-fashion-accessories-natural-freshwater-pearls-slight-differences-in-shape-and-color-are-normal-for-teenager","title":"Midnight Baroque Pearl Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eMidnight Baroque Pearl Drop Earrings reinvent classic pearl jewelry with nature’s own artistry—baroque pearls whose irregular silhouettes catch light in moonlit, unexpected ways. This is not your grandmother’s pearl earring; it’s a contemporary statement that moves with you from a gala to a refined daytime look.\u003c\/p\u003e \u003cp\u003eWhat makes these earrings truly captivating is the individuality of every pair. Each baroque pearl is one-of-a-kind, boasting its own silhouette and glow. No two pairs are alike, so you wear a piece that’s as unique as your style. The deep, midnight sheen pairs effortlessly with black-tie elegance, jewel tones, or minimalist palettes, elevating everything from gowns to tailored blazers.\u003c\/p\u003e \u003ch3\u003eKey characteristics that stand out\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eOne-of-a-kind baroque pearls:\u003c\/strong\u003e Naturally irregular shapes mean every pair has its own character and glow.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eMidnight tones:\u003c\/strong\u003e A rich, dark luster that complements formal attire and adds depth to casual outfits.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eElegant drop silhouette:\u003c\/strong\u003e A graceful line that lengthens the neckline and frames the face with modern sophistication.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eRadiant nacre interactions:\u003c\/strong\u003e Subtle play of light across the pearl surface creates a dynamic shimmer as you move.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatility in wear:\u003c\/strong\u003e Perfect for weddings, galas, date nights, or elevating everyday chic.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho’s it for\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003ePearl lovers who crave individuality and a piece that stands apart from conventional pearl earrings.\u003c\/li\u003e \u003cli\u003eFashion-forward minimalists seeking a refined, statement piece with restrained drama.\u003c\/li\u003e \u003cli\u003eAnyone looking to rotate into an accessory that transcends seasons and trends.\u003c\/li\u003e \u003cli\u003eLooking for a meaningful gift—anniversaries, milestones, or a thoughtful treat for someone who values timeless elegance with a modern edge.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eStyling ideas to make the glow your own\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003ePair with a classic little black dress or a sleek evening jumpsuit to let the irregular pearl shapes take center stage.\u003c\/li\u003e \u003cli\u003eKeep hair in a simple updo or sleek style to maximize light reflection across the baroque surface.\u003c\/li\u003e \u003cli\u003eFor daytime sophistication, combine with a monochrome blouse and tailored pants—the midnight hue adds depth without overpowering the look.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cp\u003eTo preserve their natural luster, wipe the pearls with a soft cloth after wearing and store them in a gentle pouch or jewelry box away from other pieces. Avoid harsh chemicals or abrasives, and apply fragrance or hair products before putting on earrings to maintain their glowing finish over time.\u003c\/p\u003e \u003ch3\u003eWhy these earrings elevate your jewelry repertoire\u003c\/h3\u003e\n\u003cp\u003eThe Midnight Baroque Pearl Drop Earrings offer more than a beautiful accessory—they transform how you present yourself. The combination of one-of-a-kind pearls, moonlit luster, and a fluid drop silhouette creates a memorable silhouette that looks equally stunning in candlelight and daylight. Whether you’re crafting a formal moment or adding a luxe touch to a smart-casual outfit, these earrings deliver a refined, contemporary edge that remains timeless.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210935029913,"sku":"SKU_1772560359310_850","price":31.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/3b32bcba-8252-41a1-bc0f-770358dcfaa1.jpg?v=1773196279"},{"product_id":"natural-freshwater-pearl-ring-for-women-adjustable-opening-design-retro-enamel-floral-multi-color-index-finger-ring-new-chinese-style-mothers-day-valentines-day-gift","title":"Pearl Petal Twist Open Adjustable Ring","description":"\u003cdiv\u003e\n\u003cp\u003eChoose the Pearl Petal Twist Open Adjustable Ring for a whisper-thin romance that stays with you from coffee runs to candlelit evenings. At its heart, a luminous pearl catches light from every angle, while a delicate petal-inspired band shimmers with contemporary charm. The open back isn’t just stylish—it’s a practical, adjustable fit that moves with your day, without pinching or losing its sheen.\u003c\/p\u003e \u003ch3\u003eWhat makes this ring truly stand out\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003ePearl centerpiece\u003c\/strong\u003e: A single iridescent pearl takes center stage, adding a soft, sophisticated glow that elevates both casual outfits and evening wear.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePetal twist design\u003c\/strong\u003e: The band curls into a graceful petal silhouette, delivering a feminine, modern profile that’s anything but ordinary.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eOpen adjustable fit\u003c\/strong\u003e: An open shank allows gentle sizing tweaks, so the ring flexes to your finger across different days and outfits.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e: Slim enough for everyday wear, refined for date nights, and easy to layer with other rings for a curated, contemporary stack.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eIdeal gift with meaning\u003c\/strong\u003e: A timeless piece that communicates understated elegance for birthdays, anniversaries, or a thoughtful surprise “just because.”\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCare and longevity\u003c\/strong\u003e: To preserve its glow, remove when swimming or cleaning, and wipe with a soft cloth after wear to keep the pearl and finish pristine.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eIdeal for anyone who loves a subtle statement, this ring blends classic pearl serenity with a modern silhouette. Picture it accompanying a crisp blouse at the office, peeking from beneath a cuff on a night out, or layered with other slim bands for a personalized stack that reflects your unique style. The Pearl Petal Twist Open Adjustable Ring is not just a piece of jewelry—it’s a flexible, everyday keepsake designed to adapt to life’s moments.\u003c\/p\u003e \u003cp\u003eBring a refined, contemporary touch to your jewelry collection with a piece that’s easy to wear, meaningful to gift, and engineered to stay luminous through the seasons. The Pearl Petal Twist Open Adjustable Ring is the understated elegance you’ll reach for day after day.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210936144025,"sku":"SKU_1772560408831_781","price":31.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/f2148b3f-b6e6-4a35-948c-044070932d3e.jpg?v=1773196279"},{"product_id":"bohemian-style-earrings-woven-square-pendants-with-faux-pearl-drops-elegant-for-ethnic-parties-and-everyday-wear-suitable-for-formal-or-casual-occasions-versatile-bohemian-fashion-additions-for-all-seasons","title":"Woven Square Pearl Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eWoven Square Pearl Drop Earrings fuse the timeless glow of a pearl with a contemporary geometric twist. A delicate woven square frame embraces a luminous pearl drop, crafting a silhouette that transitions effortlessly from day at the desk to an elevated evening look.\u003c\/p\u003e \u003cp\u003eArchitectural charm meets classic elegance in a pair that stands out without shouting. The square-woven motif adds clean lines and modern flair, while the pearl’s natural luster maintains its graceful heart. This balance makes the earrings a versatile choice that complements neutrals, metallics, and everything in between.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eArchitectural charm with timeless grace:\u003c\/strong\u003e A refined square-woven frame introduces contemporary texture around a pristine pearl, delivering a standout silhouette without overpowering the pearl’s subtle glow.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight, all-day comfort:\u003c\/strong\u003e Thoughtful balance and a lightweight design keep you comfortable from morning meetings to after-work plans.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless, versatile styling:\u003c\/strong\u003e Pairs beautifully with minimalist pieces for a cohesive look or coordinates with a matched set for a polished ensemble.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eIdeal for gifting:\u003c\/strong\u003e A refined, memorable present for anniversaries, birthdays, or bridal party keepsakes that feel thoughtfully chosen.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCare that preserves radiance:\u003c\/strong\u003e Gentle wiping with a soft cloth after wear, storage in a protective pouch, and avoidance of harsh chemicals or prolonged moisture keep the pearl’s glow year after year.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWho it’s for:\u003c\/strong\u003e Perfect for lovers of modern jewelry who still treasure the timeless grace of pearls. If you want an accessory that moves seamlessly between professional attire and formal wear, these earrings are your refined solution. They also make a thoughtful, lasting gift for someone who appreciates versatile, stylish jewelry.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity:\u003c\/strong\u003e To maintain their radiant finish, wipe gently with a soft, lint-free cloth after wearing, store in a protective pouch or jewelry box, and keep them away from harsh chemicals or prolonged moisture. Treat them with the same care you give pearls to preserve their natural glow for years to come.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210937913497,"sku":"SKU_1772560481435_828","price":31.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/a77354cc-341f-4e08-a9ac-13a37ba4ab07.jpg?v=1773196280"},{"product_id":"vintage-silvery-imitation-pearl-ring-wide-ring-for-women-hammered-ring-bicolor-ring-handmade-jewelry","title":"Bold Pearl Signet Dome Ring","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Bold Pearl Signet Dome Ring—a contemporary reimagining of a timeless icon. Its rounded, domed surface creates a sculptural silhouette that sits flush and comfortable on the finger, while a luminous pearl is thoughtfully set to catch light from every angle. This isn’t merely jewelry; it’s a statement piece that elevates everything from tailored outfits to relaxed everyday looks.\u003c\/p\u003e \u003ch2\u003eWhat makes it distinctly standout\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eDomed signet silhouette:\u003c\/strong\u003e a convex surface that feels substantial without shouting for attention, designed to sit flush on any finger for a clean, uninterrupted line.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePearl centerpiece:\u003c\/strong\u003e a single iridescent focal point that elevates both casual and formal ensembles with timeless glow.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePractical, refined finish:\u003c\/strong\u003e smooth edges and a polished band minimize snagging, enabling effortless transition from day to night.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eUnisex elegance:\u003c\/strong\u003e crafted to complement a wide range of styles—from tailored suiting to relaxed denim—making it a versatile addition to any jewelry collection.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eUse cases, styling ideas, and signals to wear\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eIdeal as a standout wedding anniversary or milestone gift for pearl lovers who crave a modern twist on tradition.\u003c\/li\u003e \u003cli\u003ePairs beautifully with other minimalist rings to create a curated, contemporary stack that remains effortless and wearable.\u003c\/li\u003e \u003cli\u003ePerfect for professionals seeking a refined, fashion-forward accessory that stays understated in the workday while still making a statement in photos.\u003c\/li\u003e \u003cli\u003eA versatile piece that transitions seamlessly from special occasions to everyday wear, with its understated glow reading bold in all settings.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho this ring is ideal for\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eAnyone drawn to a clean, sculptural aesthetic with a touch of classical elegance.\u003c\/li\u003e \u003cli\u003ePearl enthusiasts seeking a contemporary centerpiece that updates a timeless motif.\u003c\/li\u003e \u003cli\u003ePeople looking for a versatile piece that moves effortlessly between formal wear and casual outfits.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare, longevity, and quick maintenance tips\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eAvoid exposing the ring to harsh chemicals and chlorine; remove before swimming or cleaning with detergents.\u003c\/li\u003e \u003cli\u003eGently wipe with a soft, lint-free cloth to maintain the pearl’s luster and the band’s shine.\u003c\/li\u003e \u003cli\u003eStore separately in a soft pouch to prevent scratches and protect the pearl’s surface.\u003c\/li\u003e \u003cli\u003eFor sizing, choose a comfortable fit—the ring should slip on and off easily without forcing it over knuckles.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWhy this ring stands apart? Unlike traditional flat signets, the domed profile delivers a sculptural presence that’s equally at home in a boardroom meeting or a dinner out. The pearl isn’t merely decorative—it’s a luminescent focal point that catches light in motion, giving the piece a dynamic, eye-catching quality. Every detail is tuned for comfort and wearability without compromising bold, confident style.\u003c\/p\u003e \u003cp\u003eReady to redefine your signature look? The Bold Pearl Signet Dome Ring invites you to wear a refined, modern heirloom that grows with you—equally at home with a sharp suit or a favorite denim outfit.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"5","offer_id":46213501190297,"sku":null,"price":34.95,"currency_code":"USD","in_stock":true},{"title":"6","offer_id":46210939027609,"sku":"SKU_1772560529499_501","price":34.95,"currency_code":"USD","in_stock":true},{"title":"7","offer_id":46210939060377,"sku":"SKU_1772560529499_271","price":34.95,"currency_code":"USD","in_stock":true},{"title":"8","offer_id":46210939093145,"sku":"SKU_1772560529499_205","price":34.95,"currency_code":"USD","in_stock":true},{"title":"9","offer_id":46210939125913,"sku":"SKU_1772560529499_707","price":34.95,"currency_code":"USD","in_stock":true},{"title":"10","offer_id":46210939158681,"sku":"SKU_1772560529499_975","price":34.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/607247a7-b885-4a05-91c7-6f272ffbbeef.jpg?v=1773196280"},{"product_id":"an-asymmetrical-pearl-decorative-necklace-for-women-elegant-and-stylish-perfect-for-everyday-wear","title":"Baroque Coin Pearl Strand Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eElevate every moment with the Baroque Coin Pearl Strand Necklace—the ultimate fusion of organic, sculptural beauty and modern polish. This single strand pairs the irregular, artful shapes of Baroque pearls with the crisp, luminous discs of coin pearls, creating a necklace that reads as both timeless and decisively contemporary. The result is a piece that catches light from every angle, adding depth and dimension to any neckline.\u003c\/p\u003e \u003ch2\u003eWhy this Baroque Coin Pearl Strand Necklace stands apart\u003c\/h2\u003e\n\u003cp\u003eTwo pearl aesthetics converge in a necklace that refuses to be ordinary. The Baroque pearls contribute rich texture and a natural, museum-worthy charm, while the coin pearls provide a geometric rhythm that feels sleek and current. The combination offers a versatile statement—elegant enough for formal events, yet refined enough to elevate casual daywear without shouting for attention.\u003c\/p\u003e \u003ch3\u003eKey benefits\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eDistinctive contrast\u003c\/strong\u003e between the organic irregularity of Baroque pearls and the flat, lustrous surface of coin pearls creates visual interest from every angle.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eTimeless versatility\u003c\/strong\u003e pairs beautifully with classic silhouettes and contemporary outfits alike, making it a flexible addition to any jewelry collection.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless elegance\u003c\/strong\u003e adds immediate polish to necklines such as off-the-shoulder, boat neck, or V-neck styles, transforming everyday looks into moments of refined charm.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-key luxury\u003c\/strong\u003e—a refined statement that doesn’t rely on flash, but on the natural beauty and glow of genuine pearls.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eIdeal for\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eModern brides seeking a touch of organic luxury on their wedding day\u003c\/li\u003e \u003cli\u003eAnyone wanting a standout necklace that can transition from office wear to after-hours events\u003c\/li\u003e \u003cli\u003eGift-worthy jewelry for anniversaries, birthdays, or milestone celebrations\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003e styling ideas\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eWear it with a bateau or boat-neck top to frame the necklace and highlight the interplay between Baroque and coin pearls.\u003c\/li\u003e \u003cli\u003eLet it stand alone as a statement piece, or pair it with a delicate pendant for a curated layered look.\u003c\/li\u003e \u003cli\u003eCoordinate with metals that echo the necklace’s luster—silver or white gold undertones to maintain a cool, modern aesthetic.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eCaring for your Baroque Coin Pearl Strand Necklace\u003c\/h2\u003e\n\u003cp\u003ePearls are shimmering, delicate gems. Wipe the strand gently with a soft, damp cloth after wearing to remove oils or cosmetics, and store it in a soft pouch or jewelry box separate from harder pieces to prevent scratches. Avoid contact with perfume, hairspray, and cleaning agents, and refrain from exposing the necklace to ultrasonic cleaners or harsh chemicals.\u003c\/p\u003e \u003ch2\u003eWhat you’re getting\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eBaroque pearl strand\u003c\/strong\u003e featuring the irregular, organic shapes that give each piece its distinctive character\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCoin pearl accents\u003c\/strong\u003e for a clean, contemporary disc element that enhances light reflection\u003c\/li\u003e \u003cli\u003eA single-strand design crafted to offer a balanced, elegant silhouette against a range of necklines\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eReady to elevate your jewelry collection with a piece that merges artful imperfection with modern polish? Add the Baroque Coin Pearl Strand Necklace to your cart and experience how a pearl necklace can redefine everyday luxury.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210939748505,"sku":"SKU_1772560562756_959","price":39.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/openart-image_0nhV8Uve_1772638231529_raw.jpg?v=1773196281"},{"product_id":"ladies-pearl-earrings-featuring-natural-oversized-white-baroque-pearls-stud-earrings-for-natural-freshwater-pearls-slight-variations-in-shape-and-color-are-normal","title":"Organic Pebble Silver Stud Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eOrganic Pebble Silver Stud Earrings fuse nature-inspired charm with contemporary minimalism, delivering a refined silver silhouette that elevates any outfit without overpowering it. A small, considered detail, they shine just enough toPolish your look from desk to dinner—with an effortless, everyday appeal.\u003c\/p\u003e \u003cp\u003eCrafted around an organic pebble silhouette, these earrings embrace a natural, slightly irregular form that adds personality to a classic stud. The soft, organic contour contrasts with clean lines, creating a piece that feels both timeless and truly wearable in real life. The low-profile design sits close to the ear, offering a comfortable, all-day fit that won’t interrupt your day or your stack of bracelets and necklaces.\u003c\/p\u003e \u003ch2\u003eKey features that matter in daily wear\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eOrganic pebble silhouette:\u003c\/strong\u003e a natural, slightly irregular shape that brings character to a traditional silver stud.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSilver finish:\u003c\/strong\u003e cool-toned, versatile silver that coordinates effortlessly with other jewelry and wardrobe colors.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-profile comfort:\u003c\/strong\u003e designed to sit flush against the lobe for seamless, extended wear.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSubtle shine:\u003c\/strong\u003e a gentle catch of light that adds polish without drawing excess attention.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday versatility:\u003c\/strong\u003e ideal for workwear, relaxed weekends, and minimalist layering with other pieces.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eWhy minimalist lovers will reach for them daily\u003c\/h2\u003e\n\u003cp\u003eIf you’re drawn to clean lines and understated jewelry with a touch of organic charm, these earrings are built for your daily rotation. They pair beautifully with a crisp shirt and blazer to sharpen a professional look, brighten a casual tee-and-jeans ensemble, or complement a more elevated dress for evening events.\u003c\/p\u003e \u003ch2\u003eWho this is for\u003c\/h2\u003e\n\u003cp\u003eIdeal for anyone who appreciates a refined, unobtrusive accessory that still makes a statement. The Organic Pebble Silver Studs are a thoughtful, timeless gift for birthdays, anniversaries, or for anyone embracing minimalist style and versatile, easy-to-wear jewelry.\u003c\/p\u003e \u003cp\u003eEmbrace a small, confident detail that adapts to every moment—from early meetings to late-night outings. The Organic Pebble Silver Stud Earrings are more than an accessory; they’re a dependable cornerstone for a modern, pared-down wardrobe.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210940502169,"sku":"SKU_1772560590693_59","price":39.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/9f7c85ac-cca0-4024-96ef-9806b377714f.jpg?v=1773196283"},{"product_id":"retro-five-petal-flower-cluster-inlaid-faux-pearl-single-ring","title":"Floral Filigree Moonstone Dome Ring","description":"\u003cdiv\u003e\n\u003cp\u003eThe Floral Filigree Moonstone Dome Ring fuses luminous beauty with timeless craftsmanship, turning a single moment of light into a daily statement. Centered on a radiant moonstone beneath a softly domed bezel, this ring is framed by delicate floral filigree that recalls vintage botanical lace—a piece that feels both heirloom-worthy and unmistakably modern.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eMoonstone brilliance you can feel\u003c\/strong\u003e comes from the stone’s adularescence — a blue-white sheen that shifts as you move, ensuring no two stones look alike. In bright sun, you’ll notice a delicate, celestial glow; in softer evening light, the color softens to a silvery, dreamlike glow. Each ring is a unique canvas of color and shimmer, designed to catch the eye from across the room and up close alike.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eSecure, sculptural setting\u003c\/strong\u003e goes beyond aesthetics. The gently domed bezel centers the moonstone while providing a bold, sculpted silhouette that catches the light from all angles. The setting is crafted for durability in everyday wear, so you can enjoy the glow without worry.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eFloral filigree craftsmanship\u003c\/strong\u003e weaves petal and leaf motifs into an openwork halo around the stone. The result is a vintage-inspired charm that remains perfectly at home with contemporary wardrobes, offering a light, airy feel that won’t weigh you down while you move through your day.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eAll-day versatility\u003c\/strong\u003e means you can wear it solo for a quiet, luminous statement or stack it with other rings for a curated, dimensional look. Its slim profile and comfortable finish make it ideal for daily wear, yet special enough to elevate evenings out or milestone celebrations.\u003c\/p\u003e \u003cp\u003eThis ring is a thoughtful choice for \u003cstrong\u003emoonstone lovers\u003c\/strong\u003e and anyone drawn to botanical-inspired jewelry. It makes a meaningful gift for birthdays, anniversaries, or milestones, and it transitions seamlessly from casual days to dressier occasions.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eStyle and pairing ideas\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eLet the moonstone take center stage by pairing with silver-toned pieces or soft neutrals that let its glow shine through.\u003c\/li\u003e \u003cli\u003eLayer with slim, varied-texture bands to create a modern, dimensional stack.\u003c\/li\u003e \u003cli\u003eEcho the floral motif with a coordinating bracelet or necklace for a cohesive vintage-inspired set.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e — to preserve the moonstone’s adularescence, clean gently with mild soap and warm water, then pat dry with a soft cloth. Avoid harsh chemicals and ultrasonic cleaners. When not wearing it, store in a soft pouch or lined jewelry box to protect the delicate filigree details from scratches.\u003c\/p\u003e \u003cp\u003eElevate your everyday with the Floral Filigree Moonstone Dome Ring—a luminous centerpiece with antique-inspired charm and a contemporary wearable silhouette. Add to cart and carry a touch of moonlit enchantment today.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"5","offer_id":46213467537561,"sku":null,"price":35.95,"currency_code":"USD","in_stock":true},{"title":"6","offer_id":46210941059225,"sku":"SKU_1772560622862_442","price":35.95,"currency_code":"USD","in_stock":true},{"title":"7","offer_id":46210941091993,"sku":"SKU_1772560622862_717","price":35.95,"currency_code":"USD","in_stock":true},{"title":"8","offer_id":46210941124761,"sku":"SKU_1772560622862_1","price":35.95,"currency_code":"USD","in_stock":true},{"title":"9","offer_id":46210941157529,"sku":"SKU_1772560622862_105","price":35.95,"currency_code":"USD","in_stock":true},{"title":"10","offer_id":46210941190297,"sku":"SKU_1772560622862_147","price":35.95,"currency_code":"USD","in_stock":true},{"title":"11","offer_id":46210941223065,"sku":"SKU_1772560622862_865","price":35.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/a4ea2d8f-fdbe-4ad1-84fc-f7c2d52918f6.jpg?v=1773196282"},{"product_id":"sophisticated-imitation-pearl-earrings-featuring-unique-geometric-circles-perfect-for-womens-wedding-banquets-and-casual-parties","title":"Organic Halo Pearl Stud Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eExperience quiet luxury with the Organic Halo Pearl Stud Earrings, where a luminous pearl anchors a delicate halo of sparkle. This timeless silhouette glows from every angle, whether you’re dressing for a daily moment or a special occasion.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003ePearl centerpiece\u003c\/strong\u003e: A naturally lustrous pearl with warm iridescence sits at the heart of the design, designed to flatter a wide range of skin tones and styles. Each pearl carries its own subtle size and luster variation, making every pair feel uniquely yours.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eHalo setting\u003c\/strong\u003e: A circlet of tiny stones frames the pearl, amplifying its brilliance without overwhelming the understated elegance that makes these earrings so versatile.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eVersatile wear\u003c\/strong\u003e: From a casual tee to an evening gown, these earrings elevate everyday looks and elevate formal outfits alike. The halo halo design adds just enough flash for transitions from day to night.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eComfort and security\u003c\/strong\u003e: Lightweight studs with secure backs ensure all‑day wear without distraction. You can reach for them morning through night with confidence.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eTimeless appeal\u003c\/strong\u003e: A refined finish and classic shape make these pearl studs a lasting addition to any jewelry collection. They pair seamlessly with other pearl pieces or stand confidently on their own.\u003c\/p\u003e \u003ch3\u003eWho it's for\u003c\/h3\u003e\n\u003cp\u003eIdeal for anyone who cherishes understated elegance with a touch of luxury. Whether you’re selecting your first pair of pearl studs, searching for a bridesmaid gift, or seeking a subtle accent for a formal outfit, Organic Halo Pearl Stud Earrings offer refined simplicity that works in a variety of settings.\u003c\/p\u003e \u003ch3\u003eHow to wear and style\u003c\/h3\u003e\n\u003cp\u003eDress them up with a satin blouse for a wedding reception, or keep it casual with a knit sweater and jeans. The halo design provides just enough sparkle to carry you from desk to dinner—no extra jewelry needed.\u003c\/p\u003e \u003ch3\u003eCaring for your pearls\u003c\/h3\u003e\n\u003cp\u003ePearls are delicate and respond best to gentle care. After wear, wipe with a soft, damp cloth to remove oils and fingerprints. Store in a soft pouch or separate compartment to prevent scratches from other jewelry. Avoid exposing the earrings to harsh chemicals, perfume, or chlorinated water, which can dull luster over time.\u003c\/p\u003e \u003ch3\u003eMaterials and craftsmanship\u003c\/h3\u003e\n\u003cp\u003eDesigned to highlight the pearl’s natural beauty, the Organic Halo Pearl Stud Earrings pair a pristine pearl with a discreet halo that catches light from multiple angles. The focus on comfortable wear and secure backing ensures you enjoy the glow without distraction.\u003c\/p\u003e \u003ch3\u003eSize and variation\u003c\/h3\u003e\n\u003cp\u003eBecause pearls are natural, each piece may vary slightly in size, shape, and luster. This uniqueness is part of the charm, ensuring no two pairs are exactly alike while maintaining a cohesive look across the collection.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210941976729,"sku":"SKU_1772560658977_762","price":33.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/openart-image_wWTQjtOB_1772589937649_raw.jpg?v=1773196282"},{"product_id":"french-style-elegant-and-sexy-womens-fashion-necklace-irregular-shape-faux-imitation-pearl-unique-design-y-shaped-necklace-for-banquets-parties-festivals-weddings-mothers-day-ramadan","title":"Pearl Cascade Y-Lariat Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Pearl Cascade Y-Lariat Necklace — a contemporary spin on timeless pearl jewelry that drapes with a soft, organic elegance. The cascade of lustrous pearls traces a graceful Y-shaped line, drawing the eye to the neckline and creating a balanced, elongated silhouette.\u003c\/p\u003e \u003cp\u003eDesigned for versatility, this necklace pairs effortlessly with everything from a crisp blouse to a velvet evening dress. The cascading pearl drop catches light from every angle, adding subtle shimmer without overpowering your look. It's the kind of piece you reach for again and again, whether you're assembling a polished workwear outfit or elevating your after-hours attire.\u003c\/p\u003e \u003ch3\u003eKey features\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eCascade of pearls:\u003c\/strong\u003e A delicate string of pearl beads creates a multi-dimensional pendant that adds texture and depth to any neckline.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eY-lariat silhouette:\u003c\/strong\u003e The Y-shaped drop flatters a variety of necklines, from boat necks to V-necks, for a flattering, modern shine.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile length:\u003c\/strong\u003e Designed to drape at an optimal point across many body types, enabling a range of styling options.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless styling:\u003c\/strong\u003e Works with both casual tees and formal dresses, helping you build a capsule jewelry look with a single piece.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful construction:\u003c\/strong\u003e Built with a secure clasp and durable chain that stands up to everyday wear while offering timeless appeal.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWho is this for?\u003c\/strong\u003e Ideal for jewelry lovers who crave a piece that blends classic pearls with a contemporary shape. It’s a thoughtful gift for anniversaries, milestone celebrations, or simply to treat someone who appreciates versatile, elegant jewelry.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and wear tips:\u003c\/strong\u003e To keep the pearls lustrous, wipe with a soft cloth after wear and store in a cool, dry place. Avoid sharp pulls or exposure to harsh chemicals. This necklace deserves gentle handling to preserve its sheen over time.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhy choose the Pearl Cascade Y-Lariat Necklace over other pearl pieces?\u003c\/strong\u003e It merges refined pearl charm with a minimalist, fashion-forward silhouette. The cascading drop provides depth and movement, while the Y-lariat design ensures it sits beautifully on a range of necklines without complicated styling. If you’re shopping for a jewelry piece that transitions effortlessly from office to evening and pairs with multiple outfits, this necklace is a distinctive, everyday-luxury choice.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210942664857,"sku":"SKU_1772560691238_500","price":39.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/ed7448a5-8c9e-49d5-a6dc-01815039aff2.jpg?v=1773196284"},{"product_id":"french-style-vintage-courtly-imitation-pearl-earrings-for-women-influencer-style-elegant-high-end-enamel-drip-stud-earrings-light-luxury-ear-accessories","title":"Midnight Pearl Fringe Statement Stud Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eMidnight Pearl Fringe Statement Stud Earrings fuse timeless pearl glow with modern movement, turning everyday moments into something memorable. The deep, iridescent tones shift with light, giving each wear a quietly sophisticated edge that elevates both daytime meetings and midnight celebrations.\u003c\/p\u003e \u003ch2\u003eKey features\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eMidnight pearl luster\u003c\/strong\u003e: a rich, iridescent glow that transitions as you move, adding depth to evening looks.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eFringe drama\u003c\/strong\u003e: a delicate cascade that catches the eye with subtle motion without overpowering your silhouette.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eDiscrete, secure fit\u003c\/strong\u003e: a comfortable stud backing keeps the earrings steady through conversations, dancing, and photos.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e: complements everything from little black dresses and velvet blazers to wedding guest ensembles with a contemporary pearl accent.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless care\u003c\/strong\u003e: simple maintenance keeps the pearlescent finish luminous over time.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eWho it’s for\u003c\/h2\u003e\n\u003cp\u003eIdeal for lovers of refined sparkle who want a statement piece that remains wearable all night. Whether you’re a professional attending events, a guest at a wedding, or anyone seeking a touch of drama in a polished package, these earrings deliver a poised silhouette that looks great in photos and real life alike.\u003c\/p\u003e \u003ch2\u003eStyling ideas\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003ePair with a sleek updo to keep the fringe as the focal point and elongate the neck for evening events.\u003c\/li\u003e \u003cli\u003eCoordinate with cool-toned makeup to let the pearl’s natural glow shine through.\u003c\/li\u003e \u003cli\u003eLayer with other pearl accents for a curated, high-fashion look that remains effortless.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eWhy choose these over ordinary pearl earrings\u003c\/h2\u003e\n\u003cp\u003eThey don’t just add a classic touch—they introduce kinetic, wearable art. The fringe adds movement and intrigue without competing with your overall look, while the stud backing ensures comfort and security as you mingle, pose for photos, or take the stage. This combination of traditional pearl charm and contemporary design makes Midnight Pearl Fringe Statement Stud Earrings a distinctive choice for anyone who wants a sophisticated, ready-for-anything accessory.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210943287449,"sku":"SKU_1772560718356_168","price":33.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/470ea08a-e116-491f-bb2a-4fd7c17f3668.jpg?v=1773196285"},{"product_id":"new-cross-border-fashion-pastoral-vintage-heart-and-leaf-inlaid-imitation-pearl-earrings","title":"Pearl Cluster Leaf Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003ePearl Cluster Leaf Drop Earrings\u003c\/strong\u003e bring a refined, nature-inspired twist to timeless pearl jewelry. A delicate cluster of lustrous pearls forms a leaf motif that gracefully dangles, catching light from every angle as you move. This design blends classic elegance with a contemporary organic silhouette, giving you a piece that feels thoughtful and distinctly unique.\u003c\/p\u003e \u003cp\u003eDesigned for comfort and everyday wear, the lightweight drop construction lets you accessorize from desk to dinner without fatigue. The soft, radiant sheen of the pearls flatters a wide range of skin tones and necklines, providing a versatile finishing touch that never overshadows your outfit.\u003c\/p\u003e \u003ch3\u003eWhy these earrings stand out\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eLeaf-inspired pearl cluster:\u003c\/strong\u003e a distinctive motif that marries timeless pearl jewelry with an organic, modern shape—perfect for someone who wants jewelry that feels curated and rare.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight drop design:\u003c\/strong\u003e crafted for all-day comfort, so you can wear them from morning meetings to evening events without discomfort.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling:\u003c\/strong\u003e seamlessly elevate a crisp blouse for smart-casual days, or complement gowns and bridesmaid dresses for elegant evening occasions.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSoft, flattering glow:\u003c\/strong\u003e pearls emit a luminous sheen that enhances almost any neckline and skin tone, adding a refined radiance without overpowering your look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eWedding-ready and beyond:\u003c\/strong\u003e an ideal choice for weddings, bridal parties, anniversaries, milestone birthdays, or as a polished finishing touch to everyday outfits.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eStyling and wearability tips\u003c\/h3\u003e\n\u003cp\u003eTo showcase the leaf drop, pair these earrings with a high-neck top that lets the motif take center stage, or opt for an open neckline to let the pearl cluster shimmer along the collarbone. Their understated elegance works equally well with a tailored blazer for a smart-c casual aesthetic or with a formal gown for sophisticated evening events.\u003c\/p\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eStore in a soft pouch, away from sharp edges and chemicals, to protect the delicate pearl surface.\u003c\/li\u003e \u003cli\u003eWipe after wear with a soft cloth; avoid direct contact with perfumes or harsh cleaners.\u003c\/li\u003e \u003cli\u003eWhen needed, clean with a gentle, non-abrasive solution and dry thoroughly to preserve the natural luster.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWith the Pearl Cluster Leaf Drop Earrings, you’re choosing a piece that harmonizes classic elegance with a fresh, nature-inspired silhouette—an accessory that feels curated, not generic, and ready to accompany you through countless moments worth celebrating.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210944729241,"sku":"SKU_1772560750428_220","price":33.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/1_6190df2d-ebec-4d23-94e0-a020ecf57417.jpg?v=1773196286"},{"product_id":"2pcs-vintage-palace-style-baroque-inspired-irregular-imitation-pearl-flower-multicolor-womens-earrings-elegant-golden-tone-alloy-with-green-gemstones-perfect-for-weddings-parties-and-gifts-party-accessoriesbaroque-style-earringsalloy-earrin","title":"Floral Halo Pearl Drop Statement Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eMeet the Floral Halo Pearl Drop Statement Earrings — a romantic fusion of bloom-inspired elegance and modern shine that elevates every neckline. A luminous pearl drop sits at the center, framed by a delicate floral halo that wraps around in a silhouette instantly recognizable and uniquely yours.\u003c\/p\u003e \u003ch2\u003eWhy this pair stands out\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eDistinctive silhouette:\u003c\/strong\u003e The floral halo doesn’t merely border the pearl; it creates a focal point that draws the eye in a refined, balanced way—perfect for framing your face without overpowering your look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless versatility:\u003c\/strong\u003e Transition seamlessly from ceremony to reception, or from a polished daytime ensemble to a gala-night statement. These earrings adapt to both intimate weddings and formal events.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eTimeless materials, contemporary design:\u003c\/strong\u003e Classic pearl meets a chic bloom motif, ensuring a piece that remains stylish across seasons and trends.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEasy to accessorize:\u003c\/strong\u003e Complements a wide range of jewelry—from solitaire necklaces to delicate bracelets or a statement cuff—making it a reliable addition to any jewelry box.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eIdeal for who and when\u003c\/h3\u003e\n\u003cp\u003eDesigned for brides seeking a feminine, editorial finish, these earrings are equally at home on bridesmaids, guests, or anyone attending weddings, proms, galas, or upscale evenings. If you’re planning a lace dress, a sleek satin gown, or a sweetheart neckline, the Floral Halo Pearl Drop earrings add refined drama without stealing the spotlight from your dress.\u003c\/p\u003e \u003ch3\u003eWhat you’ll love in everyday use\u003c\/h3\u003e\n\u003cp\u003eBeyond special occasions, these earrings pair beautifully with \u003cem\u003eeveryday elegance\u003c\/em\u003e—from a dressy office look to a weekend dinner outfit. The pearl’s soft luster catches light with every movement, while the floral halo brings a touch of whimsy and romance to your ensemble.\u003c\/p\u003e \u003ch3\u003eCare, longevity, and longevity tips\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eStore in a soft pouch to prevent scratches and maintain luster.\u003c\/li\u003e \u003cli\u003eWipe gently after wear to keep the pearls gleaming.\u003c\/li\u003e \u003cli\u003eAvoid contact with perfume, hairspray, and harsh chemicals to protect the pearl’s surface and the metallic setting.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003ePractical styling tips\u003c\/h3\u003e\n\u003cp\u003ePair with a sweetheart neckline to accentuate the drop and halo silhouette, or opt for an off-the-shoulder gown to showcase the earrings from collarbone to the glow of the pearl. For brides, these earrings coordinate beautifully with ivory, champagne, or blush palettes and can be the perfect bridge between a classic pearl and a modern floral motif.\u003c\/p\u003e \u003cp\u003eElevate your jewelry collection with a piece that blends timeless pearl appeal with a contemporary floral halo twist. Add the Floral Halo Pearl Drop Statement Earrings to your cart and experience why they’re a favorite for weddings, formal events, and unforgettable evenings.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210946629785,"sku":"SKU_1772560825922_505","price":36.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/2_a8cf222d-5765-42bf-b689-178c5e958ad1.jpg?v=1773196286"},{"product_id":"natural-freshwater-iridescent-large-baroque-fancy-shaped-freshwater-pearls-earrings-french-style-light-luxury-temperament-ear-hooks-natural-freshwater-baroque-womens-stud-earrings-vintage-matte-texture-freshwater-pearlss-natural-luster-ear","title":"Baroque Pearl Drop Hook Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eNature’s unpredictable beauty meets refined elegance in the Baroque Pearl Drop Hook Earrings. Each earring showcases a single baroque pearl—born of the sea and shaped by time—gracing a graceful hook to catch the eye without overpowering your look. Because no two pearls are alike, this pair celebrates individuality, turning every wear into a personal moment of authentic, nature-made elegance.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eOne-of-a-kind baroque pearl\u003c\/strong\u003e: each pearl holds its own distinctive silhouette and iridescent shimmer, ensuring your earrings are truly unique.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eDrop silhouette in motion\u003c\/strong\u003e: designed to sway gracefully as you move, the earrings catch light from every angle for a subtle, flattering glow.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eIridiscence that flatters\u003c\/strong\u003e: the natural play of color shifts with your neckline and mood, adding a touch of understated luxury to day or night looks.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eClassic hook fastening\u003c\/strong\u003e: easy to wear and secure, making them a versatile choice for daily wear or special occasions.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless versatility\u003c\/strong\u003e: pairs beautifully with other pearl pieces for a timeless, cohesive ensemble—from a sleek blouse to a little black dress or a casual weekend outfit.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful gift option\u003c\/strong\u003e: an exquisite gesture for weddings, anniversaries, birthdays, or anyone who cherishes authentic, nature-made jewelry.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eIdeal for a wide range of moments, these Baroque Pearl Drop Hook Earrings transition from daytime polish to evening allure with seamless ease. They’re particularly striking when worn to frame the face and neckline, letting the pearls’ irregular beauty take center stage. For weddings, formal events, or intimate celebrations, these earrings offer a refined sparkle that enhances rather than competes with your overall look.\u003c\/p\u003e \u003cp\u003eCare is simple: wipe with a soft cloth after wear and store in a protective pouch to preserve their natural luster. To maximize impact, style them with outfits that highlight the ears and neckline—let the organic radiance of the baroque pearls do the talking.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210947612825,"sku":"SKU_1772560865138_995","price":39.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/0e8f13e36ceb4219b1e008500f063577-goods.jpg?v=1773196287"},{"product_id":"natural-freshwater-pearl-fan-shaped-mother-of-pearl-ring-adjustable-opening-ring-light-luxury-ins-style-elegant-temperament-womens-jewelry-gift","title":"Open Duo Pearl Wrap Ring","description":"\u003cdiv\u003e\n\u003cp\u003eThe Open Duo Pearl Wrap Ring fuses graceful motion with timeless elegance, turning every gesture into a subtle statement. Its open silhouette wraps softly around the finger, while two luminous pearls anchor the design, catching light with every turn of the hand and lending a refined glow to any look.\u003c\/p\u003e \u003cp\u003eThis ring isn’t just jewelry—it’s a story you wear. One pearl glows near the arc of the ring, the second sits offset along the wrap, so your hand tells a quiet, sophisticated narrative from every angle. The result is a piece that moves with you, seamlessly transitioning from day to night without losing its poise.\u003c\/p\u003e \u003ch3\u003eWhy this ring stands out\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eTwo pearls, one refined focal point:\u003c\/strong\u003e natural iridescence elevates casual outfits and elevates formal ensembles with a touch of oceanic shimmer.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eOpen wrap design:\u003c\/strong\u003e a flexible, comfortable fit that hugs the finger and layers beautifully with other pieces.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile pairing:\u003c\/strong\u003e neutral by design, it complements various metals and gemstones without overpowering your personal style.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eContemporary pearl lovers’ twist:\u003c\/strong\u003e a delicate silhouette with a hint of whimsy, ideal for everyday elegance or special occasions—including bridal looks.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho it’s for\u003c\/h3\u003e\n\u003cp\u003ePerfect for pearl enthusiasts seeking a modern, wearable twist, this ring suits everyday glamour, refined evening outfits, and bridal styling. It also makes a thoughtful gift for someone who appreciates a delicate, graceful silhouette with a touch of whimsy.\u003c\/p\u003e \u003ch3\u003eHow to wear and care\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003ePair with light fabrics and smooth textures to keep snagging and abrasion at bay on delicate clothing.\u003c\/li\u003e \u003cli\u003eAvoid contact with harsh chemicals, perfumes, and chlorinated water to preserve the pearls’ lustre.\u003c\/li\u003e \u003cli\u003eGently wipe with a soft cloth after wear and store separately from other jewelry to prevent scratches.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eElevate your everyday with the Open Duo Pearl Wrap Ring—a refined, versatile piece that adds a subtle, oceanic shimmer to any ensemble. Add it to your collection and let the pearls tell your story with quiet confidence.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210948595865,"sku":"SKU_1772560911896_173","price":34.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/cba76c70-e71f-4c16-a608-78ef97d73379.jpg?v=1773196298"},{"product_id":"a-pair-of-long-elegant-french-niche-designs-with-a-high-end-feel-ear-hooks-womens-korean-temperament-cold-and-cool-style-earrings-and-fashionable-womens-earrings-wedding-season-wedding","title":"Twist Loop Pearl Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eTwist Loop Pearl Drop Earrings blend timeless pearl charm with a sleek, modern silhouette—designed to move from desk to dinner with effortless grace. The refined twist loop fastening locks securely in place, delivering a secure feel without sacrificing a streamlined, minimalist profile that gracefully avoids snagging on scarves or collars.\u003c\/p\u003e \u003cp\u003eThe luminous pearl drop adds a soft, natural radiance that catches light from every angle, ensuring your look remains quietly captivating. With a lightweight construction that pairs a slim loop with a pearl drop, these earrings stay comfortable from morning meetings to late-evening engagements.\u003c\/p\u003e \u003ch2\u003eWhy these stand out\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eSecure, easy wear\u003c\/strong\u003e — twist loop fastening keeps earrings in place as you go about your day, with no fiddly clasps to fumble.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eMinimalist elegance\u003c\/strong\u003e — a slender loop and pearl drop create a refined silhouette that complements any neckline without bulk or snag hazards.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eNatural luminosity\u003c\/strong\u003e — the pearl’s glow catches light beautifully, adding a touch of sophisticated radiance to every moment.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eAll‑day comfort\u003c\/strong\u003e — lightweight design means you can wear them from desk to dinner without fatigue.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e — effortlessly elevate professional attire, enhance evening ensembles, or shine as a wedding guest accessory.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eWho it’s for\u003c\/h2\u003e\n\u003cp\u003eIdeal for anyone who appreciates a refined, understated statement. Perfect for professionals seeking a polished blazer-and-blouse look, nightlife outfits needing a touch of sophistication, or special occasions where graceful movement photographs beautifully.\u003c\/p\u003e \u003ch2\u003eStyle and care guide\u003c\/h2\u003e\n\u003cp\u003ePair these earrings with other pearl accents or let them stand alone for a minimalist moment. To preserve their glow and sheen, follow simple care steps:\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eWipe with a soft, dry cloth after wear to remove oils and moisture.\u003c\/li\u003e \u003cli\u003eStore away from direct sunlight to protect the pearl’s luster.\u003c\/li\u003e \u003cli\u003eAvoid contact with cosmetics and harsh chemicals that can dull the pearl or metal.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003ePractical tips for best results\u003c\/h2\u003e\n\u003cp\u003eFor photography or events, the gentle movement of the pearl drop adds a dynamic shimmer that looks elegant in photos and in person. If you’re building a refined jewelry capsule, these earrings pair especially well with a simple pearl or metallic accessory and a tailored suit or a classic cocktail dress.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210949578905,"sku":"SKU_1772560972048_100","price":34.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/6315e803-340d-4bc2-8d00-ed7c76f1035e.jpg?v=1773196288"},{"product_id":"bohemian-metal-oval-bead-imitation-pearl-earrings-are-suitable-for-parties-festivals-vacations-and-everyday-wear","title":"Pearl Draped U Link Drop Earrings","description":"\u003cdiv\u003e\n\u003ch2\u003ePearl Draped U Link Drop Earrings\u003c\/h2\u003e\n\u003cp\u003eWhere modern geometry meets timeless pearl luster, these Pearl Draped U Link Drop Earrings redefine everyday elegance. An ultra-slim U-shaped frame anchors a graceful cascade of pearl drops, catching the light with every subtle turn of your head for a quiet, unforgettable glow.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eArtful drape and dimensional movement\u003c\/strong\u003e: pearls cascade along a curved line, creating visual depth from every angle. The motion isn’t just beautiful to look at—it adds a dynamic, living quality to your jewelry that moves with you, not against you.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eArchitectural silhouette\u003c\/strong\u003e: the contemporary U-link elongates the neckline and companions effortlessly with gowns, tailored suits, or refined smart-casual looks. It’s a statement piece that doesn’t overwhelm your attire, instead elevating it with a poised, architectural edge.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eLightweight comfort meets standout presence\u003c\/strong\u003e: crafted to feel weightless while delivering a noteworthy presence, these earrings are designed for all-day wear—whether you’re walking the aisle, leading a presentation, or attending an evening affair.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eVersatile elegance for any occasion\u003c\/strong\u003e: refined enough for formal events, weddings, and black-tie evenings, yet simple enough to pair with jewel tones, classic neutrals, or monochrome ensembles for day-to-night versatility.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eIdeal for a thoughtful gift\u003c\/strong\u003e: a luxurious choice for birthdays, anniversaries, or special milestones—an heirloom-ready piece that can be treasured for years to come.\u003c\/p\u003e \u003ch3\u003eWho will love them\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eBrides and bridesmaids seeking a hint of tradition with a modern twist.\u003c\/li\u003e \u003cli\u003eProfessionals looking to add polish to day-to-night outfits without sacrificing comfort.\u003c\/li\u003e \u003cli\u003eJewelry lovers who appreciate pearls that move with you rather than sitting static.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eHow to wear\u003c\/h3\u003e\n\u003cp\u003ePair with a sleek updo to showcase the draping, or let the earrings frame a soft neckline and the shimmer of pearls in your hair. They pair beautifully with black-tie gowns, jewel tones, and classic neutrals alike.\u003c\/p\u003e \u003ch3\u003eCare and maintenance\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eStore in a soft pouch away from direct sunlight to preserve nacre luster.\u003c\/li\u003e \u003cli\u003eAfter wear, wipe pearls with a clean, lint-free cloth to maintain their natural shine.\u003c\/li\u003e \u003cli\u003eAvoid contact with perfumes or hairsprays to keep the nacre’s sheen intact.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eStep into a refined look with the Pearl Draped U Link Drop Earrings — where contemporary geometry meets the enduring glow of pearls. \u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210950955161,"sku":"SKU_1772561082158_152","price":34.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/2_cceb2638-dc49-4c41-89be-deb5142ea9c8.jpg?v=1773196289"},{"product_id":"women-retro-elegant-imitation-pearl-teardrop-dangle-earrings-k-plated-imitation-pearl-drop-earrings-suitable-for-daily-wear-party-jewelry-anniversary-christmas-gift-for-her-year-round-timeless-accessory","title":"Teardrop Gemstone Drop Stud Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eTeardrop Gemstone Drop Stud Earrings fuse a timeless teardrop shape with a single, radiant gemstone to create a refined, everyday luxury. Designed for quiet confidence, they add a whisper of luminosity to any moment—from Monday meetings to weekend brightenings—without stealing the stage from your entire outfit.\u003c\/p\u003e \u003ch3\u003eWhat makes these earrings unique\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eSubtle movement, stunning light.\u003c\/strong\u003e The teardrop design catches the light from every angle, creating depth and life with every head turn.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eMinimalist setting, maximum impact.\u003c\/strong\u003e A clean silhouette keeps the spotlight on the gemstone, delivering a modern, versatile look that pairs with both tailored workwear and casual denim.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eAll-day comfort.\u003c\/strong\u003e Lightweight construction means you can wear them from early alarms to late after-darks without irritation.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile by design.\u003c\/strong\u003e Equally at home layered with other delicate pieces or worn solo as a quiet statement, they adapt to casual or formal occasions.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful gift option.\u003c\/strong\u003e A timeless sparkle for birthdays, anniversaries, or a spontaneous “just because” moment for someone who loves clean, refined jewelry.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho these are for\u003c\/h3\u003e\n\u003cp\u003eIdeal for jewelry lovers who appreciate a classic teardrop shape with modern polish, these earrings suit professionals seeking a tasteful upgrade, minimalist enthusiasts building a timeless collection, and anyone who wants a go-to pair that effortlessly elevates any outfit.\u003c\/p\u003e \u003ch3\u003eStyle and pairing ideas\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eFrame the teardrop silhouette with a V-neck or off-the-shoulder top, letting the gemstone catch the light with every motion.\u003c\/li\u003e \u003cli\u003eKeep the rest of your jewelry understated—think a delicate bracelet or a simple chain necklace—to maintain an elegant, cohesive look.\u003c\/li\u003e \u003cli\u003eWear them as your main accessory for an evening out, or as a refined everyday touch to elevate your workwear.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and maintenance\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eGently wipe with a soft cloth after wear to remove oils and fingerprints.\u003c\/li\u003e \u003cli\u003eAvoid contact with harsh chemicals, perfumes, and hairspray to preserve the gemstone’s brilliance.\u003c\/li\u003e \u003cli\u003eStore in a soft pouch or jewelry box to prevent scratches and tangling with other pieces.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210953642137,"sku":"SKU_1772561232919_737","price":34.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/2134cf11a0c1431fae619d50768b66bd-goods.jpg?v=1773196288"},{"product_id":"baroque-button-shaped-freshwater-freshwater-pearls-pendant-natural-freshwater-pearls-womens-jewelry-cute-and-simple-style-natural-freshwater-pearls-slight-differences-in-shape-and-color-are-normal","title":"Vintage Baroque Pearl Pendant","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003eVintage Baroque Pearl Pendant\u003c\/strong\u003e brings a touch of old-world charm to modern jewelry collection with a single, irregular pearl that shines with natural character. This piece celebrates the beauty of imperfection, turning every angle and curve into a story you wear close to your heart.\u003c\/p\u003e \u003cp\u003eWhat makes this pendant truly unique is the baroque pearl itself — each one is naturally shaped, catching the light with a soft iridescence that shifts with every movement. Paired with a vintage-inspired setting, the pendant offers a timeless silhouette that feels both luxe and approachable, whether you’re dressing for a special occasion or elevating everyday looks.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eOne-of-a-kind Baroque Pearl:\u003c\/strong\u003e no two pendants are alike, thanks to the natural, organic shape and rich nacre that subtly shifts in color.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVintage-Influenced Design:\u003c\/strong\u003e a classic frame that enhances the pearl’s irregular beauty, resulting in a piece with enduring appeal.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile Wearability:\u003c\/strong\u003e a slender profile that pairs beautifully with a variety of chains and outfits—from casual sweaters to formal gowns.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSubtle, Luxurious Sparkle:\u003c\/strong\u003e the pearl’s nacreous luster catches light gracefully, adding depth without shouting for attention.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLayering Ready:\u003c\/strong\u003e perfect for creating a curated jewelry stack when paired with other delicate pendants or a simple chain for a minimalist look.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eThis pendant is an ideal gift for anyone who cherishes distinctive pearl jewelry, appreciates craftsmanship that highlights natural beauty, or wants a timeless piece that works across seasons. It’s especially well-suited for brides seeking a touch of vintage elegance, as well as for someone building a thoughtful, heirloom-worthy collection.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eHow to wear and care:\u003c\/strong\u003e string it on a standard chain that suits your style (chain not included), and adjust length to suit necklines. To keep the pearl’s glow, wipe gently with a soft, damp cloth after wear and store in a soft pouch away from harsh chemicals or extreme heat.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhy choose the Vintage Baroque Pearl Pendant?\u003c\/strong\u003e It’s not just a pendant—it’s a statement about embracing natural beauty and timeless design. If you’re searching for a piece that’s as individual as you are, this pendant delivers memorable character, everyday versatility, and a subtle sense of nostalgia you can wear with confidence.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210956787865,"sku":"SKU_1772561317176_451","price":34.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/1_4df6105f-463e-43c2-8c4b-dd65961b24c5.jpg?v=1773196289"},{"product_id":"natural-freshwater-pearls-actual-product-may-slightly-differ-from-images-40mm-long-3-white-natural-freshwater-pearls-with-simple-ear-hooks","title":"Triple Drop Baroque Pearl Earrings","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003eTriple Drop Baroque Pearl Earrings\u003c\/strong\u003e fuse nature’s artistry with modern minimalism. Three organically shaped baroque pearls descend in a delicate cascade, each one unique in its curve and sheen, catching light with every turn of your head. This trio creates a dynamic focal point that balances drama and refinement for any ensemble.\u003c\/p\u003e \u003ch3\u003eWhy these earrings stand out\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eThree-drop design\u003c\/strong\u003e: A graceful vertical line of pearls adds length and movement without overwhelming your silhouette.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eBaroque beauty, one-of-a-kind\u003c\/strong\u003e: Each pearl is naturally irregular, ensuring no two pairs are identical and every wearer enjoys a genuinely unique piece.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight comfort\u003c\/strong\u003e: Thoughtful construction prioritizes wearability so you can enjoy long, confident wear without fatigue.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSubtle iridescence\u003c\/strong\u003e: The baroque pearls’ soft color shifts complement a wide range of fabrics and tones.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile elegance\u003c\/strong\u003e: Transitions seamlessly from a polished work-day look to an evening statement with effortless glamour.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eIdeal for\u003c\/h3\u003e\n\u003cp\u003ePerfect for anyone who loves timeless pearl jewelry with a contemporary twist—the bride seeking a memorable non-traditional moment, professionals desiring a refined accessory that suits a boardroom or a gala, and jewelry lovers who prize individuality, since each pearl carries its own distinctive character.\u003c\/p\u003e \u003ch3\u003eStyling ideas and occasions\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003ePair with a sleek little black dress or a tailored suit to add a graceful underline of luxury on formal occasions.\u003c\/li\u003e \u003cli\u003eCoordinate with other pearl accents for a cohesive, classic look at weddings or anniversaries.\u003c\/li\u003e \u003cli\u003eWear during date nights to infuse subtle sophistication into whatever you’re wearing—let the pearls do the talking.\u003c\/li\u003e \u003cli\u003eDress up a simple blouse and jeans for a smart-casual evening that feels curated and chic.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eStore separately to prevent scratching, ideally in a soft pouch or jewelry box with a gentle lining.\u003c\/li\u003e \u003cli\u003eWipe with a soft, damp cloth after wear to remove oils and residues; avoid harsh chemicals and ultrasonic cleaners.\u003c\/li\u003e \u003cli\u003ePut on last when getting ready and remove first when winding down to minimize exposure to cosmetics and perfumes.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eThe \u003cstrong\u003eTriple Drop Baroque Pearl Earrings\u003c\/strong\u003e offer a natural, distinctive charm that’s unmistakably you. With three unique pearls cascading in a refined silhouette, they’re not just an accessory—they’re a personal style statement that elevates everyday moments and special occasions alike.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210958065817,"sku":"SKU_1772561369989_446","price":34.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/462805f1252d17bd22c26801ec1a7a5f.jpg?v=1773196295"},{"product_id":"10mm-mixed-color-abalone-shell-bead-necklace-for-women-vintage-tribal-style-luxurious-pearl-gemstone-accents-perfect-for-daily-wear-gifting-all-season-versatile-accessory-everyday-jewelryvintageinspired-necklacedurable-necklace","title":"Midnight Pearl Strand Necklace","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003eMidnight Pearl Strand Necklace\u003c\/strong\u003e is a refined expression of quiet glamour. Built around a single, uninterrupted line of pearls, it exudes a sophisticated glow that catches the eye without shouting for attention. The result is a versatile piece that elevates both everyday elegance and formal allure.\u003c\/p\u003e \u003cp\u003eDesigned for real-world moments, this necklace pairs gracefully with a range of outfits—from a tailored blazer and pencil skirt to a flowing evening gown. Its timeless silhouette flatters the neckline, creating a balanced focal point that complements skin tones and adds a touch of luxe to any complexion.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhy this necklace stands apart\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eMonochrome midnight allure:\u003c\/strong\u003e pearls with a deep, dusk-toned luster that reads as both mysterious and refined.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless versatility:\u003c\/strong\u003e transitions from day to night with ease, making it an instantly polished upgrade for many looks.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eTimeless silhouette:\u003c\/strong\u003e a classic strand that remains timeless across trends and seasons.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eIdeal for:\u003c\/strong\u003e special occasions like weddings, galas, and milestone events, as a standout accessory for bridesmaids, or as a thoughtful, enduring gift for someone who cherishes understated luxury. It also serves as a reliable finishing touch for professionals who want a refined, confident appearance without overpowering their outfit.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003ePractical styling tips\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003ePair with metallic or jewel-tone attire to let the midnight pearls emerge with radiance.\u003c\/li\u003e \u003cli\u003eLet it be the anchor piece for an otherwise minimalist ensemble—add a pair of simple stud earrings to complete the look.\u003c\/li\u003e \u003cli\u003eStore it in a soft, breathable pouch away from direct light and harsh chemicals to preserve its luster.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eEnhance your jewelry collection with a piece that speaks in a soft, luminous whisper. The \u003cstrong\u003eMidnight Pearl Strand Necklace\u003c\/strong\u003e isn’t just an accessory—it’s a statement of timeless elegance that you’ll reach for again and again.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210962161817,"sku":"SKU_1772561622482_308","price":49.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/1_ef7c4679-5a13-4ad7-b51b-8c0c159f7bdc.jpg?v=1773196293"},{"product_id":"999-sterling-silvery-zhuji-natural-freshwater-pearl-stud-earrings-full-silvery-strong-light-high-end-earrings","title":"Minimal Pearl Stud Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eTimeless, understated, and endlessly versatile, the \u003cstrong\u003eMinimal Pearl Stud Earrings\u003c\/strong\u003e let a single pristine pearl do the talking. Their clean, circular silhouette sits close to the ear, catching light with a soft, natural luster that elevates any look without shouting for attention.\u003c\/p\u003e \u003cp\u003eDesigned for everyday elegance, these earrings shine in moments big and small—from boardroom confidence to weekend brunch with friends. They’re not loud accessories; they’re a quiet, confident statement that blends with your personal style while enhancing it.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhy these stand out\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003ePure, circular silhouette\u003c\/strong\u003e that pairs effortlessly with everything—from tailored blazers to casual knits.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile wear\u003c\/strong\u003e—wear solo for a refined, uncluttered look or mix with other studs for a modern, layered effect.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eTimeless iridescence\u003c\/strong\u003e—the pearl’s natural glow flatters all skin tones and color palettes, adding a touch of refined luxury to any outfit.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eHeritage meets modern elegance\u003c\/strong\u003e—a classic piece that fits seamlessly into contemporary jewelry wardrobes.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWho it's for\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eMinimalist jewelry lovers seeking a signature piece that enhances rather than overwhelms the neckline.\u003c\/li\u003e \u003cli\u003eProfessionals who need a polished finish that transitions from day to night with ease.\u003c\/li\u003e \u003cli\u003eGift buyers looking for a universally flattering, enduring present for birthdays, anniversaries, graduations, or bridesmaids.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eTo maintain the pearl’s luster, wipe gently with a soft, dry cloth after wear.\u003c\/li\u003e \u003cli\u003eStore in a jewelry box or pouch to prevent scratches and keep the pearl’s glow intact.\u003c\/li\u003e \u003cli\u003eAvoid contact with harsh chemicals or cleaners, which can dull the pearl’s natural shine.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eStyle ideas and pairing tips\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eTeam them with a crisp white shirt or a simple dress for a timeless, elevate-the-basics moment.\u003c\/li\u003e \u003cli\u003eCreate a contemporary, layered look by pairing these with other delicate earrings—perfect for weddings, dinners, and parties.\u003c\/li\u003e \u003cli\u003eExperiment with metal tones: cool-tone metals for a refreshed contrast, or warm-toned palettes for a soft, cohesive glow.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eReady to simplify your jewelry wardrobe with a piece that blends heritage and modern elegance? The \u003cstrong\u003eMinimal Pearl Stud Earrings\u003c\/strong\u003e deliver everyday sophistication and a refined glow you’ll reach for again and again.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210963275929,"sku":"SKU_1772561684062_166","price":32.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/2_65164036-2550-4c8f-badc-944d74c30306.jpg?v=1773196294"},{"product_id":"a-large-baroque-pearl-ring-for-women-made-of-natural-freshwater-featuring-a-classic-and-stylish-adjustable-size-suitable-for-everyday-wear-and-parties-making-it-an-ideal-gift-for-anniversaries-birthdays-mothers-day-and-other-celebrations","title":"Moonlit Baroque Pearl Halo Ring","description":"\u003cdiv\u003e\n\u003cp\u003eMoonlit Baroque Pearl Halo Ring captures the magic of a quiet, moonlit evening in a single, stunning piece. A singular baroque pearl—naturally irregular, softly luminous—takes center stage while a delicate halo of tiny accent stones flickers with light from every angle. This isn’t a standard pearl ring; it’s a conversation piece that blends timeless elegance with a contemporary edge.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eOne-of-a-kind centerpiece\u003c\/strong\u003e — no two rings are alike. The baroque pearl’s unique shape and inner glow tell a personal story, ensuring your ring is as individual as you are.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eHalo brilliance\u003c\/strong\u003e — a micro-stone halo surrounds the pearl, elevating its natural sheen without overpowering the centerpiece. The result is a subtle, yet unmistakable radiance that catches light from every direction.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eMoonlit aesthetic\u003c\/strong\u003e — cool, ethereal tones give the ring a refined glow that pairs beautifully with evening wear, icy palettes, and even softer casual looks. It’s a versatile centerpiece that elevates gowns, blouses, and denim alike.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e — ideal for weddings, anniversaries, date nights, or simply elevating daily ensembles. Wear it as a statement of quiet luxury or as a refined accent to complete a look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eDistinctive elegance\u003c\/strong\u003e — a refined silhouette that feels both contemporary and timeless, making this ring a meaningful gift for someone who values natural beauty and individuality in fine jewelry.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWhy this ring stands apart\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eIrregular beauty\u003c\/strong\u003e — the baroque pearl’s natural asymmetry makes every piece genuinely unique, with a character you won’t find in traditional round designs.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLight-enhancing halo\u003c\/strong\u003e — the surrounding stones magnify the pearl’s glow while preserving a delicate balance that remains wearable for daily moments and grander celebrations alike.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eMoonlit mood\u003c\/strong\u003e — the cool, luminous palette complements cooler tones and evening wear, creating a soft, ethereal presence that stays elegant in any setting.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eCare and wear\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eProtect the pearl’s natural luster by removing the ring during activities involving harsh chemicals or abrasive environments.\u003c\/li\u003e \u003cli\u003eStore in a soft pouch away from direct sunlight to preserve its delicate glow between wears.\u003c\/li\u003e \u003cli\u003eWipe gently with a damp, lint-free cloth after wearing to remove oils and keep the halo sparkling.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWith the Moonlit Baroque Pearl Halo Ring, you’re choosing a piece that feels personal and elevated—an exquisite expression of natural beauty crafted to enhance moments, from intimate dinners to grand celebrations. Whether you’re shopping for yourself or searching for a thoughtful gift for someone who cherishes individuality, this ring delivers a rare combination of character, radiance, and everyday wearability.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210971730073,"sku":"SKU_1772562248054_565","price":39.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/2_301026cf-6673-4861-96d3-b0069e0ed342.jpg?v=1773196296"},{"product_id":"a-pair-of-high-end-pearl-like-design-earrings-made-of-316l-stainless-steel-featuring-a-summer-flower-hoop-design-that-is-easy-yet-exquisite-vintage-and-elegant-suitable-for-women-couples-and-dates","title":"Pearl Petal Daisy Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003ePearl Petal Daisy Drop Earrings bring a fresh, floral glow to every look. Crafted to mimic a tiny daisy, these earrings feature layered petal-shaped pearl accents that surround a luminous center, all suspended in a graceful drop that catches light with every move. This isn’t just jewelry—it’s a subtle celebration of everyday romance expressed through motion and shimmer.\u003c\/p\u003e \u003ch2\u003eWhy these earrings stand out\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003ePlayful yet polished\u003c\/strong\u003e: the daisy motif delivers a delicate, nature-inspired silhouette that transitions effortlessly from desk to date night.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLayered pearl texture\u003c\/strong\u003e: the multi-petal construction adds depth and tactile interest, giving your look a refined, romantic dimension.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight and comfortable\u003c\/strong\u003e: designed for extended wear without fatigue, so you can sparkle from morning meetings to after-hours events.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile pairing\u003c\/strong\u003e: beautifully complements neutrals, soft pastels, and metallics, and suits a wide range of necklines and hairstyles.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eIdeal for\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eEveryday elegance: elevate workwear or casual outfits with a hint of refined charm.\u003c\/li\u003e \u003cli\u003eSpecial occasions: a delicate, eye-catching accent for weddings, parties, and date nights.\u003c\/li\u003e \u003cli\u003eThoughtful gifting: a meaningful choice for birthdays, anniversaries, or bridesmaids’ gifts.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eReal-world wear and styling ideas\u003c\/h2\u003e\n\u003cp\u003ePair these earrings with a low neckline and a soft updo to let the petals catch the light, or let them graze your hair for a slightly more statement-making effect. They shine just as beautifully with a simple sweater and jeans as they do with a sleek gown, offering a versatile option for those who love understated floral accents without overpowering their outfit.\u003c\/p\u003e \u003ch2\u003eCare and longevity\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eWipe gently with a soft, dry cloth after wear to preserve their luster.\u003c\/li\u003e \u003cli\u003eStore separately in a cool, dry place away from direct sunlight and chemicals.\u003c\/li\u003e \u003cli\u003eAvoid contact with perfumes and hairspray to maintain the natural sheen of the pearls.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eKey takeaways\u003c\/h2\u003e\n\u003cp\u003eThe Pearl Petal Daisy Drop Earrings deliver a timeless, nature-inspired motif with modern, wearable appeal. They’re the perfect accessory for anyone who loves a delicate bloom that elevates every moment—from casual coffee dates to black-tie evenings.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210972156057,"sku":"SKU_1772562279432_610","price":36.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/f07815953ee64a53b303017805ca64f7-goods.jpg?v=1773196296"},{"product_id":"an-elegant-lapis-lazuli-and-faux-pearl-necklace-uniquely-beaded-handcrafted-as-a-birthday-gift-for-women","title":"Midnight Lapis Pearl Pendant Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Midnight Lapis Pearl Pendant Necklace—a refined fusion of celestial depth and luminous elegance. This pendant pairs a mesmerizing midnight-blue lapis gemstone with a pristine pearl, creating a timeless centerpiece that shifts from subtle daytime polish to unforgettable evening glamour.\u003c\/p\u003e \u003cp\u003eWhat makes this necklace stand out:\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eStriking contrast\u003c\/strong\u003e: The deep, velvet-blue of midnight lapis against the soft glow of a pearl creates a sophisticated two-tone focal point that instantly elevates any outfit.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile silhouette\u003c\/strong\u003e: A delicate pendant suspended on a slim chain anchors your look without overpowering it, making it perfect for both minimalists and those who love a classic, refined style.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless pairing\u003c\/strong\u003e: Works beautifully with monochrome wardrobes, office-ready ensembles, or special-occasion attire, and it layers gracefully with other necklaces for a curated, personal statement.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eQuality that endures\u003c\/strong\u003e: Designed to be worn from day to night, this piece brings a touch of timeless charm to any collection and makes a meaningful gift for birthdays, anniversaries, or “just because.”\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eIdeal for lovers of elegant, nature-inspired jewelry, this Midnight Lapis Pearl Pendant Necklace is crafted to highlight the juxtaposition of a velvety blue gemstone and a luminous pearl. Whether you’re dressing for a formal event, a romantic date, or a stylish day at the office, this piece adds a refined glow that’s unmistakably you.\u003c\/p\u003e \u003cp\u003eCare and wear tips: store gently to avoid scratches, wipe with a soft cloth after wear, and keep away from harsh chemicals to preserve the stone’s luster and the pearl’s sheen.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210972549273,"sku":"SKU_1772562310998_910","price":44.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/1_10dd7b35-a08f-44f0-b0f8-9fc9460d8390.jpg?v=1773196298"},{"product_id":"firework-brooch-elegant-and-sophisticated-corsage-light-luxury-high-end-feel-for-suits-sweaters-and-coat-decorative-pins","title":"Luxury Pearl Cascade Brooch","description":"\u003cdiv\u003e\n\u003cp\u003eElevate your look with the Luxury Pearl Cascade Brooch—a refined centerpiece that turns any outfit into a moment of understated drama. A delicate cascade of lustrous pearls rests within a sleek metal setting, catching light from every angle and delivering a soft, timeless glow that speaks to true craftsmanship.\u003c\/p\u003e \u003cp\u003eDesign that stands apart. Each pearl is hand-selected for lustre and size variation, creating a natural, flowing waterfall rather than a rigid strand. The result is a versatile accessory that pairs with everything from a tailored blazer to a velvet evening gown, adding vertical length and a touch of vintage-inspired romance without feeling fussy.\u003c\/p\u003e \u003ch3\u003eKey features that matter\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eCascade silhouette\u003c\/strong\u003e brings movement and focal point to shoulders, lapels, or neckline—perfect for photos and real-life moments alike.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e works with formal wear, bridal ensembles, or elevated everyday looks—lace, satin, or structured fabrics all benefit from a single, elegant accent.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSecure, discreet clasp\u003c\/strong\u003e keeps the brooch in place through a night of toasts and dancing, with minimal bulk so it lies flat against fabric.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eUnique, handcrafted appeal\u003c\/strong\u003e no two brooches are exactly the same, thanks to the natural variation of each pearl and careful hand-assembly.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eGift-ready luxury\u003c\/strong\u003e arrives in refined packaging, making it an effortless choice for anniversaries, weddings, or a meaningful surprise for someone special.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho is this for?\u003c\/h3\u003e\n\u003cp\u003eThe Luxury Pearl Cascade Brooch is ideal for anyone seeking to add a sophisticated focal point to formal attire, bridal looks, or polished professional ensembles. It’s particularly well-suited for brides seeking a timeless, pearl-forward accent, guests attending black-tie events, and fashion-conscious individuals who value subtle yet memorable details.\u003c\/p\u003e \u003ch3\u003ePractical styling ideas\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003ePin it to the left side of a satin gown’s bodice for a eye-catching vertical line.\u003c\/li\u003e \u003cli\u003eDress up a blazer or tuxedo lapel with a delicate pearl drizzle that draws attention without overpowering the outfit.\u003c\/li\u003e \u003cli\u003eAttach to a silk scarf or shawl to transform a simple wrap into a statement piece.\u003c\/li\u003e \u003cli\u003eUse as a bridal veil pin or bouquet accent for a cohesive, pearl-led wedding look.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cp\u003eTo maintain its luminous appeal, store the Luxury Pearl Cascade Brooch in a soft pouch away from direct sunlight. Avoid contact with oils and cosmetics; gently wipe with a clean, dry cloth after wear to preserve the pearls’ natural sheen.\u003c\/p\u003e \u003cp\u003eWith the Luxury Pearl Cascade Brooch, a single, well-placed pearl accent becomes the defining detail of your outfit—elevating ordinary moments into something memorable.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210973204633,"sku":"SKU_1772562353782_786","price":32.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/2_28bf1369-a9f1-4401-a006-6224cd5bed5c.jpg?v=1773930137"},{"product_id":"new-stainless-steel-water-wave-chain-necklace-for-women-a-unique-gift-for-valentines-day-featuring-a-faux-pearl-and-lotus-leaf-pendant-trendy-and-creative-in-a-light-luxury-style","title":"Seashell Pearl Pendant Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eRadiate coastal elegance with the Seashell Pearl Pendant Necklace, a refined fusion of ocean-inspired charm and timeless pearl refinement. This piece centers a luminous pearl within a delicately sculpted seashell motif, pairing organic beauty with a clean, modern silhouette that suits everyday wear and special occasions alike.\u003c\/p\u003e \u003cp\u003eWhat makes this necklace stand out?\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eSeashell-inspired pendant\u003c\/strong\u003e frames a natural, glowing pearl, offering a look that’s instantly memorable and distinctly sea‑born.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSubtle, versatile silhouette\u003c\/strong\u003e pairs with everything from soft knits and sundresses to sleek evening wear, making it a go-to accessory across seasons.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLight-catching elegance\u003c\/strong\u003e the pearl’s iridescent luster shifts with movement, adding a touch of drama without overpowering your outfit.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless everyday sophistication\u003c\/strong\u003e crafted for comfort and long-lasting wear, so you can add a touch of coastal glamour to any look.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eDesigned for moments big and small, this seashell-inspired pearl necklace is ideal for a range of occasions:\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003eBeach weddings or seaside getaways where a subtle, natural statement is perfect\u003c\/li\u003e \u003cli\u003eEveryday meals, workdays, and weekend outings that call for a polished finish\u003c\/li\u003e \u003cli\u003eGifts for birthdays, anniversaries, or “just because” moments to celebrate her style\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWhy choose the Seashell Pearl Pendant Necklace over a standard pearl strand? It blends the organic texture of a seashell with the timeless glow of a pearl, creating a piece that feels both heirloom‑worthy and contemporary. The result is a necklace that sparks conversations and complements a wide range of fashion moods—from casual chic to refined glamour.\u003c\/p\u003e \u003cp\u003eCare and wear tips to keep the pearl looking pristine: store away from direct sunlight when not in use, wipe gently with a soft, dry cloth after wear, and avoid contact with harsh cosmetics or perfumes to preserve the pearl’s natural luster.\u003c\/p\u003e \u003cp\u003eEmbrace a touch of the coast in your jewelry collection with the Seashell Pearl Pendant Necklace—a thoughtfully designed piece that speaks to beachy nostalgia and everyday elegance in one graceful pendant.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"White Pearl","offer_id":46210973663385,"sku":"SKU_1772562384882_547","price":31.95,"currency_code":"USD","in_stock":true},{"title":"Black Pearl","offer_id":46210973630617,"sku":"SKU_1772562384882_233","price":31.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/8c6c9a49e870e8944ec20a53dc630e00.jpg?v=1773873974"},{"product_id":"vintage-imitation-pearl-bracelet-multi-imitation-pearl-smooth-beads-look-fine-jewelry-gift-suitable-for-daily-wear-weddings-parties-special-occasions-year-round-elegant-accessory","title":"Luna Bead Adjustable Bracelet","description":"\u003cdiv\u003e\n\u003cp\u003eThe Luna Bead Adjustable Bracelet brings a touch of moonlit elegance to your daily look. Designed around a simple, intuitive sliding mechanism, this bracelet sizes itself to fit with effortless finesse—so you get a secure, comfortable feel without fumbling with clasps. \u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless adjustability.\u003c\/strong\u003e A smooth sliding knot lets you dial in the perfect fit for any wrist size, ensuring it stays snug when you move and sit softly when you rest.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCelestial bead palette.\u003c\/strong\u003e Deep, night-sky hues paired with subtle silver accents evoke lunar glow, making it seamless to wear from casual days to evening outings.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-profile, durable design.\u003c\/strong\u003e The bead arrangement sits close to the skin for a refined silhouette, while the cords and bead cores are chosen to endure day‑to‑day wear without losing shape.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling.\u003c\/strong\u003e Layer it with other bracelets for a curated, boho-chic stack or wear solo as a delicate focal point. It transitions from workdays to weekends with ease.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eGift-ready for celestial dreamers.\u003c\/strong\u003e A thoughtful present for birthdays, anniversaries, or “just because” moments—perfect for astrology lovers, moon-gazers, or anyone drawn to moonlit aesthetics.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWho should reach for the Luna Bead Adjustable Bracelet? If you crave a jewelry piece that blends accessibility with a touch of magic, this bracelet is for you. It’s ideal for minimalists who appreciate subtle sparkle, travelers who need reliable fit on the go, and anyone building a layered look that doesn’t overpower their outfit. \u003c\/p\u003e \u003cp\u003ePractical use tips: start with a comfortable fit around your wrist, then adjust as needed for activity or layering. Pair it with a silver chain necklace or a set of thin, stacking bracelets to echo the lunar theme without competing for attention. To care, wipe gently with a soft cloth after wear and avoid prolonged exposure to water or harsh chemicals to preserve the bead colors and glow.\u003c\/p\u003e \u003cp\u003eEmbrace the quiet radiance of the night sky with the Luna Bead Adjustable Bracelet—a small piece with a big impact, designed to accompany you from sunup to starlight.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210974220441,"sku":"SKU_1772562414359_759","price":36.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/1_c6cb97a6-6cd8-4d5d-ae70-0cbb392cb68d.jpg?v=1773196301"},{"product_id":"womens-fashion-pendant-ring-imitation-pearl-love-earrings-personality-daily-wear-date-gift-creative-fashion-jewelry-low-allergy","title":"Heart Huggie Earrings with Beadwork","description":"\u003cdiv\u003e\n\u003cp\u003eHeart Huggie Earrings with Beadwork fuse a delicate heart motif with artisan beadwork, delivering a fresh take on the classic hoop. Each pair captures a touch of whimsy and a hint of artistry, turning everyday wear into something distinctly beautiful that catches the light with every move. Crafted for comfort and everyday versatility, these huggie earrings sit close to the ear for a secure, quintessentially chic silhouette. The smooth inner curve glides on easily, while the beadwork adds texture and color that elevates even the simplest outfit—from a white tee to a little black dress.\u003c\/p\u003e \u003ch3\u003eWhat makes these earrings special\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eHandcrafted beadwork\u003c\/strong\u003e — tiny beads are meticulously applied to form a heart accent along the hoop, delivering a handmade, textured finish that’s truly one of a kind.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eHuggie hoop design\u003c\/strong\u003e — a compact, low-profile silhouette that hugs the earlobe for a secure, everyday fit.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSkin-friendly construction\u003c\/strong\u003e — built on a hypoallergenic base to minimize irritation and suit sensitive ears.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless versatility\u003c\/strong\u003e — seamless transition from casual days to dressier evenings, pairing beautifully with denim, a tee, or a tailored blouse.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eUnique, wearable art\u003c\/strong\u003e — no two pairs are exactly alike, thanks to handcrafted beadwork that reveals subtle variations and texture.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eGift-ready and thoughtful\u003c\/strong\u003e — a charming, handcrafted piece that makes a memorable gift for someone who appreciates individual jewelry with character.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eIdeal use cases\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eEveryday wear: add personality to jeans and a tee without overpowering your look.\u003c\/li\u003e \u003cli\u003eLayered styling: mix with other delicate hoops or studs for a curated, multi-piece vibe.\u003c\/li\u003e \u003cli\u003eEvent-ready touch: pair with a dress or blouse for a polished, understated statement at dinners or gatherings.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eStore in a soft pouch away from moisture to protect the bead texture.\u003c\/li\u003e \u003cli\u003eApply perfumes and lotions before putting them on to minimize residue on the beads and metal.\u003c\/li\u003e \u003cli\u003eWipe gently with a dry cloth after wear to maintain the finish.\u003c\/li\u003e \u003cli\u003eAvoid swimming or showering while wearing to preserve the beadwork and hoop finish.\u003c\/li\u003e \u003cli\u003eBecause the beadwork is handcrafted, each pair may exhibit delightful, slight variations that make your earrings uniquely yours.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eDesigned for anyone who loves subtle sparkle, textured detail, or handmade accessories, these heart beadwork huggies are a reliable, eye-catching addition to any jewelry stack. They’re not just earrings—they’re a small, wearable piece of artisanal craft that enhances everyday moments and special occasions alike.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210975039641,"sku":"SKU_1772562459738_921","price":34.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/41bcf018b5bc69c54c7f34142a0c49a4.jpg?v=1773196303"},{"product_id":"1pc-elegant-double-layer-faux-pearl-tassel-necklace-vintage-style-zinc-alloy-adjustable-bead-count-for-daily-party-wear-all-season-accessory","title":"Pearl Y Chain Layered Necklace","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003ePearl Y Chain Layered Necklace\u003c\/strong\u003e — a refined, everyday piece that elevates your look with a timeless pearl touch and a modern Y-shaped silhouette.\u003c\/p\u003e \u003cp\u003eDesigned as a single, layered statement, this necklace combines delicate pearl accents with a slim chain that drapes in a graceful Y. The result is a versatile piece that works whether you're pairing it with a crisp blouse for the office or a sleek dress for an evening out.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhy this piece stands out\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eOne-piece layered look:\u003c\/strong\u003e achieve the chic, layered effect without juggling multiple necklaces.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePearl accents:\u003c\/strong\u003e lustrous beads lend a touch of sophistication that catches the light from every angle.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless pairing:\u003c\/strong\u003e complements necklines from crew to sweetheart, and blends seamlessly with other jewelry pieces.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday elegance:\u003c\/strong\u003e a timeless silhouette that stays polished from morning meetings to after-hours events.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWho it's for\u003c\/strong\u003e — ideal for anyone who wants to add a touch of luxury to their everyday wardrobe: professionals seeking a polished look, students stepping into the workplace, or anyone who appreciates a subtly elevated accessory that pairs with almost anything.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e — wipe gently with a soft cloth after wear, store in a cool, dry place, and avoid contact with harsh chemicals or water to preserve the pearl luster and the chain’s finish.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCompetitive edge\u003c\/strong\u003e — this Pearl Y Chain Layered Necklace delivers the visual impact of a two-layer design in a single piece, reducing tangles and coordination hassles while remaining flexible enough to wear solo or layered with other pieces for different occasions.\u003c\/p\u003e \u003cp\u003eReady to elevate your jewelry collection? Add the Pearl Y Chain Layered Necklace to your cart and enjoy effortless sophistication that fits any occasion.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Mabel Mae Margot","offers":[{"title":"Default Title","offer_id":46210977923225,"sku":"SKU_1772562630489_949","price":39.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0714\/0235\/6889\/files\/1_0d022086-1d3d-421a-92c2-052a35aa8d14.jpg?v=1773196305"}],"url":"https:\/\/mabelmaemargot.com\/collections\/fresh-water-pearls.oembed?page=4","provider":"Mabel Mae Margot","version":"1.0","type":"link"}